« Back
Home /
CD19 Rabbit mAb

CD19 Rabbit mAb

Item no.	A26042-1000uL
Manufacturer	Abclonal
Amount	1000 uL
Quantity options	1000 uL 100 uL 20 uL 500 uL
Category	Oncology Antibodies By Cell Type Hematology Leukemia Lymphoma Flow Cytometry Immunohistochemistry Western Blot ELISA Immunofluorescence Immunocytochemistry Primary Antibodies Immunostaining Immunochemistry
Type	Antibody Monoclonal
Applications	FC, IF, ICC, ELISA, IHC-P
Specific against	Mouse (Murine, Mus musculus)
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
NCBI	Cd19
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	Cd19
Available
Manufacturer - Category	Monoclonal Antibodies
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Protein Weight	60kDa
Background	Involved in several processes, including B-1 B cell differentiation; positive regulation of phosphatidylinositol 3-kinase activity; and positive regulation of release of sequestered calcium ion into cytosol. Acts upstream of or within B cell receptor signaling pathway. Located in external side of plasma membrane. Is integral component of plasma membrane. Is expressed in liver and spleen. Human ortholog(s) of this gene implicated in common variable immunodeficiency. Orthologous to human CD19 (CD19 molecule).
Manufacturer - Cross Reactivity	Human, Mouse
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 19-287 of mouse CD19 (NP_033974.2).
Recommended Dilution	IHC-P, 1:200 - 1:800\|IF/ICC, 1:200 - 1:800\|FC, 1:1000 - 1:2000\|ELISA, Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Route	Recombinant protein
Manufacturer - Research Area	Immunology Adaptive Immunity B Cells CDStem Cells Hematopoietic Progenitors Hematopoietic Stem Cells Human Lineage NegativeStem Cells Hematopoietic Progenitors Lymphoid B Lymphocytic Lineage.
Antigen Seq	RPQKSLLVEVEEGGNVVLPCLPDSSPVSSEKLAWYRGNQSTPFLELSPGSPGLGLHVGSLGILLVIVNVSDHMGGFYLCQKRPPFKDIWQPAWTVNVEDSGEMFRWNASDVRDLDCDLRNRSSGSHRSTSGSQLYVWAKDHPKVWGTKPVCAPRGSSLNQSLINQDLTVAPGSTLWLSCGVPPVPVAKGSISWTHVHPRRPNVSLLSLSLGGEHPVREMWVWGSLLLLPQATALDEGTYYCLRGNLTIERHVKVIARSAVWLWLLRTGG
Manufacturer - Gene ID (Human)	930
Expected Protein Size	60kDa
Gene Symbol	Cd19

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A26042-1000uL-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 1000 uL

available

Delivery expected until 11/27/2025

Compare

Add to wishlist

Get an offer

Request delivery time