« Back
Home /
Ku80 Rabbit pAb

Ku80 Rabbit pAb

Item no.	A13369-100ul
Manufacturer	Abclonal
Amount	100 ul
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category	Antibodies Immunohistochemistry Western Blot Primary Antibodies
Type	Antibody Polyclonal
Applications	WB, ELISA, IHC-P
Specific against	Human (Homo sapiens)
Host	Rabbit
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	IEAKKKDQVTAQEIFQDNHEDGPTAKKLKTEQGGAHFSVSSLAEGSVTSVGSVNPAENFRVLVKQKKASFEEASNQLINHIEQFLDTNETPYFMKSIDCIRAFREEAIKFSEEQRFNNFLKALQEKVEIKQLNHFWEIVVQDGITLITKEEASGSSVTAEEAKKFLAPKDKPSGDTAAVFEEGGDVDDLLDMI
NCBI	XRCC5
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	KU80, KUB2, Ku86, NFIV, KARP1, KARP-1, Ku80
Shipping Condition	Cool pack
Available
Manufacturer - Category	Polyclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Background	The protein encoded by this gene is the 80-kilodalton subunit of the Ku heterodimer protein which is also known as ATP-dependant DNA helicase II or DNA repair protein XRCC5. Ku is the DNA-binding component of the DNA-dependent protein kinase, and it functions together with the DNA ligase IV-XRCC4 complex in the repair of DNA double-strand break by non-homologous end joining and the completion of V(D)J recombination events. This gene functionally complements Chinese hamster xrs-6, a mutant defective in DNA double-strand break repair and in ability to undergo V(D)J recombination. A rare microsatellite polymorphism in this gene is associated with cancer in patients of varying radiosensitivity.
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 540-732 of human Ku80 (NP_066964.1).
Recommended Dilution	WB, 1:500 - 1:2000\|IHC-P, 1:50 - 1:200
Protein Size	83kDa
Route	Recombinant protein
Manufacturer - Research Area	Epigenetics Nuclear Signaling, DNA Damage Repair, RNA Binding

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A13369-100ul-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ul

available

Delivery expected until 8/28/2025

Compare

Add to wishlist

Get an offer

Request delivery time