« Back
Home /
Defb26 Rabbit pAb

Defb26 Rabbit pAb

Item no.	A15903-200ul
Manufacturer	Abclonal
Amount	200 ul
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category	Antibodies Immunofluorescence Primary Antibodies
Type	Antibody Polyclonal
Applications	IF, ICC, ELISA
Specific against	Rat (Rattus norvegicus)
Host	Rabbit
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	WRRMPPKCWKDNLGRCRVRCRGDERYIYLCRNKANCCILLTLAEDQSAHPKPTSVHPENVTWKNTSISPTTRYIDDITLDKTSIGTPTNVAGIGKALNLTVITPTHP
NCBI	DEFB126
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	DEFB126, C20orf8, DEFB-26, DEFB26, HBD26, bA530N10.1, hBD-26, Defb26
Shipping Condition	Cool pack
Available
Manufacturer - Category	Polyclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Background	Predicted to be involved in defense response to bacterium and innate immune response. Predicted to be located in extracellular region. Orthologous to human DEFB125 (defensin beta 125).
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 22-128 of rat Defb26 (NP_001032595.1).
Recommended Dilution	IF/ICC, 1:50 - 1:200
Protein Size	14kDa
Route	Recombinant Protein

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A15903-200ul-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 200 ul

available

Delivery expected until 9/4/2025

Compare

Add to wishlist

Get an offer

Request delivery time