« Back
Home /
UBC Rabbit pAb

UBC Rabbit pAb

Item no.	A3207-200ul
Manufacturer	Abclonal
Amount	200 ul
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category	Oncology Antibodies Cell Biology Cell Status Flow Cytometry Immunohistochemistry Western Blot ELISA Immunofluorescence Immunocytochemistry Autophagy Primary Antibodies By Organ Breast Cancer Immunostaining Immunochemistry
Type	Antibody Polyclonal
Applications	WB, IF, ICC, ELISA, IHC-P
Specific against	Human (Homo sapiens)
Host	Rabbit
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIE
NCBI	UBC
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	HMG20,UBC
Similar products	Ubiquitin C
Shipping Condition	Cool pack
Available
Manufacturer - Category	Polyclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Protein Weight	77kDa
Background	This gene represents a ubiquitin gene, ubiquitin C. The encoded protein is a polyubiquitin precursor. Conjugation of ubiquitin monomers or polymers can lead to various effects within a cell, depending on the residues to which ubiquitin is conjugated. Ubiquitination has been associated with protein degradation, DNA repair, cell cycle regulation, kinase modification, endocytosis, and regulation of other cell signaling pathways.
Manufacturer - Cross Reactivity	Human, Mouse, Rat
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human UBC (NP_066289.3).
Recommended Dilution	WB, 1:1000 - 1:2000\|IHC-P, 1:50 - 1:100\|IF/ICC, 1:50 - 1:200
Protein Size	77kDa
Route	Synthetic peptide
Manufacturer - Research Area	Cell Biology Developmental Biology, Apoptosis, Mitochondrial Control of Apoptosis, Ubiquitin, Ubiquitin-Proteasome Signaling Pathway.
Antigen Seq	MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIE
Manufacturer - Gene ID (Human)	7316
Expected Protein Size	77kDa
Gene Symbol	UBC

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A3207-200ul-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 200 ul

available

Delivery expected until 12/25/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer