« Back
Home /
CAMK4 Rabbit pAb

CAMK4 Rabbit pAb

Item no.	A5304-200ul
Manufacturer	Abclonal
Amount	200 ul
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category	Neuroscience Neural Lineage Markers Antibodies Immunohistochemistry Western Blot ELISA Immunofluorescence Immunocytochemistry Primary Antibodies Immunostaining Stem Cell Markers Immunochemistry
Type	Antibody Polyclonal
Applications	WB, IF, ICC, ELISA, IHC-P
Specific against	Human (Homo sapiens)
Host	Rabbit
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	AANFVHMDTAQKKLQEFNARRKLKAAVKAVVASSRLGSASSSHGSIQESHKASRDPSPIQDGNEDMKAIPEGEKIQGDGAQAAVKGAQAELMKVQALEKVKGADINAEEAPKMVPKAVEDGIKVADLELEEGLAEEKLKTVEEAAAPREGQGSSAVGFEVPQQDVILPEY
NCBI	CAMK4
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	caMK,CaMKIV,CaMK IV,CaMK-GR,CAMK4
Similar products	CAMK4
Shipping Condition	Cool pack
Available
Manufacturer - Category	Polyclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Protein Weight	52kDa
Background	The product of this gene belongs to the serine/threonine protein kinase family, and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. This enzyme is a multifunctional serine/threonine protein kinase with limited tissue distribution, that has been implicated in transcriptional regulation in lymphocytes, neurons and male germ cells.
Manufacturer - Cross Reactivity	Human, Mouse, Rat
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 304-473 of human CAMK4 (NP_001735.1).
Recommended Dilution	WB, 1:500 - 1:1000\|IHC-P, 1:50 - 1:200\|IF/ICC, 1:50 - 1:200
Protein Size	52kDa
Route	Recombinant protein
Manufacturer - Research Area	Epigenetics Nuclear Signaling, Signal Transduction, G protein signaling, G-Protein-Coupled Receptors Signaling to MAPK Erk, Kinase, Serine threonine kinases, ErbB-HER Signaling Pathway, Cell Biology Developmental Biology, Microtubules, Immunology Inflammation, B Cell Receptor Signaling Pathway, T Cell Receptor Signaling Pathway, Neuroscience, Calcium Signaling.
Antigen Seq	AANFVHMDTAQKKLQEFNARRKLKAAVKAVVASSRLGSASSSHGSIQESHKASRDPSPIQDGNEDMKAIPEGEKIQGDGAQAAVKGAQAELMKVQALEKVKGADINAEEAPKMVPKAVEDGIKVADLELEEGLAEEKLKTVEEAAAPREGQGSSAVGFEVPQQDVILPEY
Manufacturer - Gene ID (Human)	814
Expected Protein Size	52kDa
Gene Symbol	CAMK4

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A5304-200ul-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 200 ul

available

Delivery expected until 12/18/2025

Compare

Add to wishlist

Get an offer

Request delivery time