« Back
Home /
OCA2 Rabbit pAb

OCA2 Rabbit pAb

Item no.	A5653-200ul
Manufacturer	Abclonal
Amount	200 ul
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category	Oncology Antibodies Immunohistochemistry Western Blot Primary Antibodies By Organ Heart & Blood Cancer
Type	Antibody Polyclonal
Applications	WB, ELISA
Specific against	Human (Homo sapiens)
Host	Rabbit
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	MHLEGRDGRRYPGAPAVELLQTSVPSGLAELVAGKRRLPRGAGGADPSHSCPRGAAGQSSWAPAGQEFASFLTKGRSHSSLPQMSSSRSKDSCFTENTPLLRNSLQEKGSRCIPVYHPEFITAEESWEDSSADWERRYLLSREVSGLSASASSEKGDLLDSPHIRLRLSKLRRCVQWLKV
NCBI	OCA2
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	P,BEY,PED,BEY1,BEY2,BOCA,EYCL,HCL3,EYCL2,EYCL3,SHEP1,D15S12,OCA2
Similar products	OCA2
Shipping Condition	Cool pack
Available
Manufacturer - Category	Polyclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Protein Weight	93kDa
Background	This gene encodes the human homolog of the mouse p (pink-eyed dilution) gene. The encoded protein is believed to be an integral membrane protein involved in small molecule transport, specifically tyrosine, which is a precursor to melanin synthesis. It is involved in mammalian pigmentation, where it may control skin color variation and act as a determinant of brown or blue eye color. Mutations in this gene result in type 2 oculocutaneous albinism. Alternative splicing results in multiple transcript variants.
Manufacturer - Cross Reactivity	Human, Mouse
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human OCA2 (NP_000266.2).
Recommended Dilution	WB, 1:500 - 1:2000
Protein Size	93kDa
Route	Recombinant protein
Manufacturer - Research Area	Cancer, Signal Transduction, Endocrine Metabolism, Amino acid metabolism.
Antigen Seq	MHLEGRDGRRYPGAPAVELLQTSVPSGLAELVAGKRRLPRGAGGADPSHSCPRGAAGQSSWAPAGQEFASFLTKGRSHSSLPQMSSSRSKDSCFTENTPLLRNSLQEKGSRCIPVYHPEFITAEESWEDSSADWERRYLLSREVSGLSASASSEKGDLLDSPHIRLRLSKLRRCVQWLKV
Manufacturer - Gene ID (Human)	4948
Expected Protein Size	93kDa
Gene Symbol	OCA2

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A5653-200ul-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 200 ul

available

Delivery expected until 10/9/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer