« Back
Home /
FABP5 Rabbit pAb

FABP5 Rabbit pAb

Item no.	A6373-100ul
Manufacturer	Abclonal
Amount	100 ul
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category	Oncology Metabolism Glucose Homeostasis Cholesterol & Lipid Metabolism Antibodies Immunohistochemistry Western Blot Immunofluorescence Primary Antibodies By Organ Testicular & Prostate Cancer Pancreatic Cancer
Type	Antibody Polyclonal
Applications	WB, IF, ICC, ELISA, IHC-P
Specific against	Human (Homo sapiens)
Host	Rabbit
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE
NCBI	FABP5
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	EFABP,KFABP,E-FABP,PAFABP,PA-FABP,FABP5
Shipping Condition	Cool pack
Available
Manufacturer - Category	Polyclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3.
Protein Weight	15kDa
Background	This gene encodes the fatty acid binding protein found in epidermal cells, and was first identified as being upregulated in psoriasis tissue. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABPs may play roles in fatty acid uptake, transport, and metabolism. Polymorphisms in this gene are associated with type 2 diabetes. The human genome contains many pseudogenes similar to this locus.
Manufacturer - Cross Reactivity	Human, Mouse, Rat
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-135 of human FABP5 (NP_001435.1).
Recommended Dilution	WB, 1:500 - 1:1000\|IHC-P, 1:50 - 1:200\|IF/ICC, 1:50 - 1:200
Protein Size	15kDa
Route	Recombinant protein
Manufacturer - Research Area	Cancer, Signal Transduction, Endocrine Metabolism, Lipid Metabolism, Cardiovascular, Lipids, Fatty Acids.
Antigen Seq	MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE
Manufacturer - Gene ID (Human)	2171
Expected Protein Size	15kDa
Gene Symbol	FABP5

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A6373-100ul-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ul

available

Delivery expected until 10/2/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer