Comparison

CD117/c-Kit Rabbit pAb European Partner

Item no. A7521-200ul
Manufacturer Abclonal
Amount 200 ul
Quantity options 1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category
Type Antibody Polyclonal
Applications WB, ELISA
Specific against Human (Homo sapiens)
Host Rabbit
Isotype IgG
Conjugate/Tag Unconjugated
Purity Affinity purification
Sequence SSPYPGMPVDSKFYKMIKEGFRMLSPEHAPAEMYDIMKTCWDADPLKRPTFKQIVQLIEKQISESTNHIYSNLANCSPNRQKPVVDHSVRINSVGSTASSSQPLLVHDDV
NCBI KIT
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias PBT,SCFR,C-Kit,CD117,MASTC,CD117/c-Kit
Shipping Condition Cool pack
Available
Manufacturer - Category
Polyclonal Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Protein Weight
110kDa
Background
This gene encodes a receptor tyrosine kinase. This gene was initially identified as a homolog of the feline sarcoma viral oncogene v-kit and is often referred to as proto-oncogene c-Kit. The canonical form of this glycosylated transmembrane protein has an N-terminal extracellular region with five immunoglobulin-like domains, a transmembrane region, and an intracellular tyrosine kinase domain at the C-terminus. Upon activation by its cytokine ligand, stem cell factor (SCF), this protein phosphorylates multiple intracellular proteins that play a role in in the proliferation, differentiation, migration and apoptosis of many cell types and thereby plays an important role in hematopoiesis, stem cell maintenance, gametogenesis, melanogenesis, and in mast cell development, migration and function. This protein can be a membrane-bound or soluble protein. Mutations in this gene are associated with gastrointestinal stromal tumors, mast cell disease, acute myelogenous leukemia, and piebaldism. Multiple transcript variants encoding different isoforms have been found for this gene.
Manufacturer - Cross Reactivity
Human, Mouse, Rat
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 867-976 of human CD117/c-Kit (NP_000213.1).
Recommended Dilution
WB, 1:1000 - 1:5000
Protein Size
110kDa
Route
Recombinant protein
Manufacturer - Research Area
Protein phosphorylation, Cancer, Signal Transduction, Kinase, Tyrosine kinases, Cell Biology Developmental Biology, Growth factors, Immunology Inflammation, CDs, Cytokines, Neuroscience, Cell Type Marker, Stem Cells, Germline Stem Cells, Hematopoietic Progenitors.
Antigen Seq
SSPYPGMPVDSKFYKMIKEGFRMLSPEHAPAEMYDIMKTCWDADPLKRPTFKQIVQLIEKQISESTNHIYSNLANCSPNRQKPVVDHSVRINSVGSTASSSQPLLVHDDV
Manufacturer - Gene ID (Human)
3815
Expected Protein Size
110kDa
Gene Symbol
KIT

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 200 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close