Comparison

CST7 Rabbit pAb European Partner

Item no. A8164-200ul
Manufacturer Abclonal
Amount 200 ul
Quantity options 1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category
Type Antibody Polyclonal
Applications WB, IF, ICC, ELISA
Specific against Human (Homo sapiens)
Host Rabbit
Isotype IgG
Conjugate/Tag Unconjugated
Purity Affinity purification
Sequence GPSPDTCSQDLNSRVKPGFPKTIKTNDPGVLQAARYSVEKFNNCTNDMFLFKESRITRALVQIVKGLKYMLEVEIGRTTCKKNQHLRLDDCDFQTNHTLKQTLSCYSEVWVVPWLQHFEVPVLRCH
NCBI CST7
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias CMAP,CST7
Shipping Condition Cool pack
Available
Manufacturer - Category
Polyclonal Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Background
The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions. This gene encodes a glycosylated cysteine protease inhibitor with a putative role in immune regulation through inhibition of a unique target in the hematopoietic system. Expression of the protein has been observed in various human cancer cell lines established from malignant tumors.
Manufacturer - Cross Reactivity
Human, Mouse
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 20-145 of human CST7 (NP_003641.3).
Recommended Dilution
WB, 1:500 - 1:2000|IF/ICC, 1:50 - 1:200
Protein Size
16kDa
Route
Recombinant protein
Manufacturer - Research Area
Cell Biology Developmental Biology, Apoptosis, Caspases, Cardiovascular, Angiogenesis

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 200 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close