« Back
Home /
PARL Rabbit pAb

PARL Rabbit pAb

Item no.	A8232-100ul
Manufacturer	Abclonal
Amount	100 ul
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category	Metabolism Diabetes Antibodies Western Blot Primary Antibodies
Type	Antibody Polyclonal
Applications	WB, IF, ICC, ELISA
Specific against	Human (Homo sapiens)
Host	Rabbit
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	MAWRGWAQRGWGCGQAWGASVGGRSCEELTAVLTPPQLLGRRFNFFIQQKCGFRKAPRKVEPRRSDPGTSGEAYKRSALIPPVEETVFYPSPYPIRSLIKPLFFTVGFTGCAFGSAAIWQYESLKSRVQSYFDGIKADWLDSIRPQKEGDFRKEINKWWNNLSDGQRTVT
NCBI	PARL
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	PSARL,PSARL1,RHBDS1,PRO2207,PSENIP2,PARL
Shipping Condition	Cool pack
Available
Manufacturer - Category	Polyclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Protein Weight	42kDa
Background	This gene encodes a member of the rhomboid family of intramembrane serine proteases that is localized to the inner mitochondrial membrane. The encoded protein regulates mitochondrial remodeling and apoptosis through regulated substrate proteolysis. Proteolytic processing of the encoded protein results in the release of a small peptide, P-beta, which may transit to the nucleus. Mutations in this gene may be associated with Parkinson's disease.
Manufacturer - Cross Reactivity	Human
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human PARL (NP_001032728.1).
Recommended Dilution	WB, 1:500 - 1:2000\|IF/ICC, 1:50 - 1:200
Protein Size	42kDa
Route	Recombinant protein
Manufacturer - Research Area	Cell Biology Developmental Biology, Apoptosis, Ubiquitin, Endocrine Metabolism, Mitochondrial metabolism, Mitochondrial markers, Neuroscience, Neurodegenerative Diseases, Amyloid Plaque and Neurofibrillary Tangle Formation in Alzheimer's Disease.
Antigen Seq	MAWRGWAQRGWGCGQAWGASVGGRSCEELTAVLTPPQLLGRRFNFFIQQKCGFRKAPRKVEPRRSDPGTSGEAYKRSALIPPVEETVFYPSPYPIRSLIKPLFFTVGFTGCAFGSAAIWQYESLKSRVQSYFDGIKADWLDSIRPQKEGDFRKEINKWWNNLSDGQRTVT
Manufacturer - Gene ID (Human)	55486
Expected Protein Size	42kDa
Gene Symbol	PARL

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A8232-100ul-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ul

available

Delivery expected until 10/2/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer