Comparison

JAM2 Rabbit pAb European Partner

Item no. A9978-200ul
Manufacturer Abclonal
Amount 200 ul
Quantity options 1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category
Type Antibody Polyclonal
Applications WB, ELISA
Specific against Human (Homo sapiens)
Host Rabbit
Isotype IgG
Conjugate/Tag Unconjugated
Purity Affinity purification
Sequence FSAPKDQQVVTAVEYQEAILACKTPKKTVSSRLEWKKLGRSVSFVYYQQTLQGDFKNRAEMIDFNIRIKNVTRSDAGKYRCEVSAPSEQGQNLEEDTVTLEVLVAPAVPSCEVPSSALSGTVVELRCQDKEGNPAPEYTWFKDGIRLLENPRLGSQSTNSSYTMNTKTGTLQFNTVSKLDTGEYSCEARNSVGYRRCPGKRMQVDDLNIS
NCBI JAM2
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias JAMB, CD322, IBGC8, JAM-B, VEJAM, PRO245, VE-JAM, C21orf43, JAM2
Shipping Condition Cool pack
Available
Manufacturer - Category
Polyclonal Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Availability
Inquiry before order
Background
This gene belongs to the immunoglobulin superfamily, and the junctional adhesion molecule (JAM) family. The protein encoded by this gene is a type I membrane protein that is localized at the tight junctions of both epithelial and endothelial cells. It acts as an adhesive ligand for interacting with a variety of immune cell types, and may play a role in lymphocyte homing to secondary lymphoid organs. Alternatively spliced transcript variants have been found for this gene.
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 29-238 of human JAM2 (NP_067042.1).
Recommended Dilution
WB, 1:500 - 1:1000
Protein Size
33kDa
Route
Recombinant protein
Manufacturer - Research Area
Signal Transduction, Cell Biology Developmental Biology, Cell Adhesion, Tight Junctions, Cytoskeleton, Immunology Inflammation, CDs, Cardiovascular

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 200 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close