« Back
Home /
C/EBPB Rabbit pAb

C/EBPB Rabbit pAb

Item no.	A0711-50ul
Manufacturer	Abclonal
Amount	50 ul
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category	Metabolism Diabetes Antibodies Western Blot Primary Antibodies
Type	Antibody Polyclonal
Applications	WB, ELISA, IHC-P
Specific against	Human (Homo sapiens)
Host	Rabbit
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	AELKAEPGFEPADCKRKEEAGAPGGGAGMAAGFPYALRAYLGYQAV
NCBI	CEBPB
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	TCF5,IL6DBP,NF-IL6,C/EBP-beta,C/EBPB
Similar products	CRP2, LAP, C/EBP-beta, IL6DBP, NF-IL6, TCF5
Shipping Condition	Cool pack
Available
Manufacturer - Category	Polyclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3.
Protein Weight	36kDa
Background	This intronless gene encodes a transcription factor that contains a basic leucine zipper (bZIP) domain. The encoded protein functions as a homodimer but can also form heterodimers with CCAAT/enhancer-binding proteins alpha, delta, and gamma. Activity of this protein is important in the regulation of genes involved in immune and inflammatory responses, among other processes. The use of alternative in-frame AUG start codons results in multiple protein isoforms, each with distinct biological functions.
Manufacturer - Cross Reactivity	Human, Mouse, Rat
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 171-216 of human C/EBPB (NP_005185.2).
Recommended Dilution	WB, 1:500 - 1:1000\|IHC-P, 1:50 - 1:200
Protein Size	36kDa
Route	Recombinant protein
Manufacturer - Research Area	Epigenetics Nuclear Signaling, Transcription Factors, Protein phosphorylation, Signal Transduction, MAPK-Erk Signaling Pathway, Cell Biology Developmental Biology, Apoptosis, Cell Adhesion, Wnt ��-Catenin Signaling Pathway, Endocrine Metabolism, Endocrine and metabolic diseases, Diabetes, Immunology Inflammation, Jak-Stat-IL-6 Receptor Signaling Pathway, Cardiovascular, Heart, Hypertrophy.
Antigen Seq	AELKAEPGFEPADCKRKEEAGAPGGGAGMAAGFPYALRAYLGYQAV
Manufacturer - Gene ID (Human)	1051
Expected Protein Size	36kDa
Gene Symbol	CEBPB

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A0711-50ul-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 50 ul

available

Delivery expected until 10/9/2025

Express Delivery: Save 6 days

Compare

Add to wishlist

Get an offer