Comparison

NF-κB2 Rabbit pAb European Partner

Item no. A11163-100ul
Manufacturer Abclonal
Amount 100 ul
Quantity options 1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category
Type Antibody Polyclonal
Applications WB, IF, ICC, ELISA
Specific against Human (Homo sapiens)
Host Rabbit
Isotype IgG
Conjugate/Tag Unconjugated
Purity Affinity purification
Sequence AGADIHAENEEPLCPLPSPPTSDSDSDSEGPEKDTRSSFRGHTPLDLTCSTKVKTLLLNAAQNTMEPPLTPPSPAGPGLSLGDTALQNLEQLLDGPEAQGSWAELAERLGLRSLVDTYRQTTSPSGSLLRSYELAGGDLAGLLEALSDMGLEEGVRLLRGPETRDKLPSTEVKEDSAYGSQSVEQEAEKLGPPPEPPGGLCHGHPQPQVH
NCBI NFKB2
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias p52,p100,H2TF1,LYT10,CVID10,LYT-10,NF-kB2,p49/p100,NF-κB2
Shipping Condition Cool pack
Available
Manufacturer - Category
Polyclonal Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Protein Weight
97kDa
Background
This gene encodes a subunit of the transcription factor complex nuclear factor-kappa-B (NFkB). The NFkB complex is expressed in numerous cell types and functions as a central activator of genes involved in inflammation and immune function. The protein encoded by this gene can function as both a transcriptional activator or repressor depending on its dimerization partner. The p100 full-length protein is co-translationally processed into a p52 active form. Chromosomal rearrangements and translocations of this locus have been observed in B cell lymphomas, some of which may result in the formation of fusion proteins. There is a pseudogene for this gene on chromosome 18. Alternative splicing results in multiple transcript variants.
Manufacturer - Cross Reactivity
Human, Mouse
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 690-899 of human NF-κB2 (NP_002493.3).
Recommended Dilution
WB, 1:500 - 1:2000|IF/ICC, 1:50 - 1:200
Protein Size
97kDa
Route
Recombinant protein
Manufacturer - Research Area
Epigenetics Nuclear Signaling, Transcription Factors, Protein phosphorylation, Cancer, Signal Transduction, Cell Biology Developmental Biology, Apoptosis, Inhibition of Apoptosis, Death Receptor Signaling Pathway, Immunology Inflammation, B Cell Receptor Signaling Pathway, T Cell Receptor Signaling Pathway, Jak-Stat-IL-6 Receptor Signaling Pathway, NF-kB Signaling Pathway.
Antigen Seq
AGADIHAENEEPLCPLPSPPTSDSDSDSEGPEKDTRSSFRGHTPLDLTCSTKVKTLLLNAAQNTMEPPLTPPSPAGPGLSLGDTALQNLEQLLDGPEAQGSWAELAERLGLRSLVDTYRQTTSPSGSLLRSYELAGGDLAGLLEALSDMGLEEGVRLLRGPETRDKLPSTEVKEDSAYGSQSVEQEAEKLGPPPEPPGGLCHGHPQPQVH
Manufacturer - Gene ID (Human)
4791
Expected Protein Size
97kDa
Gene Symbol
NFKB2

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close