Comparison

Leptin Rabbit pAb European Partner

Item no. A1300-100ul
Manufacturer Abclonal
Amount 100 ul
Quantity options 1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category
Type Antibody Polyclonal
Applications WB, IF, ICC, ELISA
Specific against Human (Homo sapiens)
Host Rabbit
Isotype IgG
Conjugate/Tag Unconjugated
Purity Affinity purification
Sequence MHWGTLCGFLWLWPYLFYVQAVPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISND
NCBI LEP
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias OB,OBS,LEPD,Leptin
Similar products Leptin, LEP, OB, OBS, Obese protein, Obesity factor
Shipping Condition Cool pack
Available
Manufacturer - Category
Polyclonal Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Protein Weight
19kDa
Background
This gene encodes a protein that is secreted by white adipocytes into the circulation and plays a major role in the regulation of energy homeostasis. Circulating leptin binds to the leptin receptor in the brain, which activates downstream signaling pathways that inhibit feeding and promote energy expenditure. This protein also has several endocrine functions, and is involved in the regulation of immune and inflammatory responses, hematopoiesis, angiogenesis, reproduction, bone formation and wound healing. Mutations in this gene and its regulatory regions cause severe obesity and morbid obesity with hypogonadism in human patients. A mutation in this gene has also been linked to type 2 diabetes mellitus development.
Manufacturer - Cross Reactivity
Human, Mouse, Rat
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Leptin (NP_000221.1).
Recommended Dilution
WB, 1:500 - 1:1000|IF/ICC, 1:50 - 1:200
Protein Size
19kDa
Route
Synthetic peptide
Manufacturer - Research Area
Cancer, Signal Transduction, Cell Biology Developmental Biology, Growth factors, Endocrine Metabolism, Endocrine and metabolic diseases, Diabetes, Obesity, Neuroscience, Stem Cells, Mesenchymal Stem Cells, Cardiovascular, Heart, Cardiovascular diseases, Heart disease.
Antigen Seq
MHWGTLCGFLWLWPYLFYVQAVPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISND
Manufacturer - Gene ID (Human)
3952
Expected Protein Size
19kDa
Gene Symbol
LEP

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close