Comparison

Map2 Rabbit pAb European Partner

Item no. A3278-20ul
Manufacturer Abclonal
Amount 20 ul
Quantity options 1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category
Type Antibody Polyclonal
Applications WB, ELISA
Specific against Mouse (Murine, Mus musculus)
Host Rabbit
Isotype IgG
Conjugate/Tag Unconjugated
Purity Affinity purification
Sequence MADERKDEAKAPHWTSAPLTEASAHSHPPEIKDQGGAGEGLVRSANGFPYREDEEGAFGEHGSQGTYSNTKENGINGELTSADRETAEEVSARIVQVVTA
NCBI Map2
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias MAP-2,Mtap2,Mtap-2,repro4,G1-397-34,Map2
Shipping Condition Cool pack
Available
Manufacturer - Category
Polyclonal Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Background
Enables microtubule binding activity. Involved in microtubule cytoskeleton organization; negative regulation of axon extension; and regulation of protein localization. Acts upstream of or within several processes, including establishment of cell polarity; microtubule bundle formation; and neuron projection development. Located in several cellular components, including axon; dendrite; and proximal neuron projection. Is expressed in several structures, including back skin; central nervous system; peripheral nervous system ganglion; retina; and trigeminal nerve. Orthologous to human MAP2 (microtubule associated protein 2).
Manufacturer - Cross Reactivity
Human, Mouse
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Map2 (P11137).
Recommended Dilution
WB, 1:500 - 1:1000
Protein Size
200kDa
Route
Synthetic peptide
Manufacturer - Research Area
Signal Transduction, Cell Biology & Developmental Biology, Cell Adhesion, Cytoskeleton, Microtubules, Neuroscience, Cell Type Marker, Stem Cells, Neuron marker

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 20 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close