Comparison

TrKC Rabbit pAb European Partner

Item no. A5842-20ul
Manufacturer Abclonal
Amount 20 ul
Quantity options 1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category
Type Antibody Polyclonal
Applications WB, IF, ICC, ELISA
Specific against Human (Homo sapiens)
Host Rabbit
Isotype IgG
Conjugate/Tag Unconjugated
Purity Affinity purification
Sequence KTEINCRRPDDGNLFPLLEGQDSGNSNGNASINITDISRNITSIHIENWRSLHTLNAVDMELYTGLQKLTIKNSGLRSIQPRAFAKNPHLRYINLSSNRLTTLSWQLFQTLSLRELQLEQNFFNCSCDIRWMQLWQEQGEAKLNSQNLYCINADGSQLPLFRMNISQCDLPEISVSHVNLTVREGDNAVITCNGSGSPLPDVDWIVTGLQSINTHQTNLNWTNVHAINLTLVNVTSEDNGFTLTCIAENVVGMSN
NCBI NTRK3
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias TRKC, GP145-TrkC, gp145(trkC), TrKC
Shipping Condition Cool pack
Available
Manufacturer - Category
Polyclonal Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Background
This gene encodes a member of the neurotrophic tyrosine receptor kinase (NTRK) family. This kinase is a membrane-bound receptor that, upon neurotrophin binding, phosphorylates itself and members of the MAPK pathway. Signalling through this kinase leads to cell differentiation and may play a role in the development of proprioceptive neurons that sense body position. Mutations in this gene have been associated with medulloblastomas, secretory breast carcinomas and other cancers. Several transcript variants encoding different isoforms have been found for this gene.
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 40-300 of human TrKC (NP_001007157.1).
Recommended Dilution
WB, 1:500 - 1:2000|IF/ICC, 1:50 - 1:200
Protein Size
94kDa
Route
Recombinant protein
Manufacturer - Research Area
Cancer, Signal Transduction, Kinase, Tyrosine kinases, Cell Biology Developmental Biology, Growth factors, Neuroscience

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 20 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close