« Back
Home /
COX1 Rabbit pAb

COX1 Rabbit pAb

Item no.	A7531-100ul
Manufacturer	Abclonal
Amount	100 ul
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category	Neuroscience Molecular Targets for Neuroscience Aging & Neurological Disorders Antibodies Immunohistochemistry Western Blot Cardiovascular Research Atherosclerosis Primary Antibodies
Type	Antibody Polyclonal
Applications	WB, ELISA, IHC-P
Specific against	Mouse (Murine, Mus musculus)
Host	Rabbit
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	AIMFVGVNMTFFPQHFLGLSGMPRRYSDYPDAYTTWNTVSSMGSFISLTAVLIMIFMIWEAFASKREVMSVSYASTNLEWLHGCPPPYHTFEEPTYVKVK
NCBI	mt-Co1
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	CoxI, COX1
Shipping Condition	Cool pack
Available
Manufacturer - Category	Polyclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Background	Enables cytochrome-c oxidase activity. Predicted to be involved in electron transport coupled proton transport; mitochondrial electron transport, cytochrome c to oxygen; and response to oxidative stress. Located in mitochondrial inner membrane. Part of mitochondrial respiratory chain complex IV. Is expressed in several structures, including brown fat; heart; liver; metanephros; and skeletal muscle. Orthologous to human MT-CO1 (mitochondrially encoded cytochrome c oxidase I).
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 415-514 of mouse COX1 (NP_904330.1).
Recommended Dilution	WB, 1:100 - 1:500\|IHC-P, 1:50 - 1:200
Protein Size	56kDa
Route	Synthetic peptide
Manufacturer - Research Area	Cancer, Signal Transduction, Endocrine & Metabolism, Mitochondrial metabolism, Mitochondrial markers, Oxidative phosphorylation, Neuroscience, Neurodegenerative Diseases

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A7531-100ul-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ul

available

Delivery expected until 8/14/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer