« Back
Home /
PBEF/Visfatin/NAMPT Rabbit pAb

PBEF/Visfatin/NAMPT Rabbit pAb

Item no.	A0256-20ul
Manufacturer	Abclonal
Amount	20 ul
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category	Oncology Metabolism Glucose Homeostasis Cholesterol & Lipid Metabolism Regulation of Appetite Antibodies By Cell Type Carcinoma Obesity Immunohistochemistry Western Blot Immunofluorescence Endocrine Regulation of Lipid Metabolism Primary Antibodies
Type	Antibody Polyclonal
Applications	WB, IF, ICC, ELISA, IHC-P
Specific against	Human (Homo sapiens)
Host	Rabbit
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	GNLDGLEYKLHDFGYRGVSSQETAGIGASAHLVNFKGTDTVAGLALIKKYYGTKDPVPGYSVPAAEHSTITAWGKDHEKDAFEHIVTQFSSVPVSVVSDSYDIYNACEKIWGEDLRHLIVSRSTQAPLIIRPDSGNPLDTVLKVLEILGKKFPVTENSKGYKLLPPYLRVIQGDGVDINTLQEIVEGMKQKMWSIENIAFGS
NCBI	NAMPT
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	VF,PBEF,PBEF1,VISFATIN,1110035O14Rik,PBEF/Visfatin/NAMPT
Shipping Condition	Cool pack
Available
Manufacturer - Category	Polyclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Protein Weight	56kDa
Background	This gene encodes a protein that catalyzes the condensation of nicotinamide with 5-phosphoribosyl-1-pyrophosphate to yield nicotinamide mononucleotide, one step in the biosynthesis of nicotinamide adenine dinucleotide. The protein belongs to the nicotinic acid phosphoribosyltransferase (NAPRTase) family and is thought to be involved in many important biological processes, including metabolism, stress response and aging. This gene has a pseudogene on chromosome 10.
Manufacturer - Cross Reactivity	Human, Mouse, Rat
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 181-382 of human PBEF/Visfatin/NAMPT (NP_005737.1).
Recommended Dilution	WB, 1:1000 - 1:5000\|IHC-P, 1:50 - 1:200\|IF/ICC, 1:50 - 1:200
Protein Size	56kDa
Route	Recombinant protein
Manufacturer - Research Area	Cancer, Signal Transduction, Cell Biology Developmental Biology, Growth factors, Endocrine Metabolism, Immunology Inflammation, Cytokines, Cell Intrinsic Innate Immunity Signaling Pathway, Neuroscience, Cardiovascular, Blood, Serum Proteins, Hypoxia.
Antigen Seq	GNLDGLEYKLHDFGYRGVSSQETAGIGASAHLVNFKGTDTVAGLALIKKYYGTKDPVPGYSVPAAEHSTITAWGKDHEKDAFEHIVTQFSSVPVSVVSDSYDIYNACEKIWGEDLRHLIVSRSTQAPLIIRPDSGNPLDTVLKVLEILGKKFPVTENSKGYKLLPPYLRVIQGDGVDINTLQEIVEGMKQKMWSIENIAFGS
Manufacturer - Gene ID (Human)	10135
Expected Protein Size	56kDa
Gene Symbol	NAMPT

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A0256-20ul-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 20 ul

available

Delivery expected until 10/9/2025

Express Delivery: Save 6 days

Compare

Add to wishlist

Get an offer