« Back
Home /
GATA1 Rabbit pAb

GATA1 Rabbit pAb

Item no.	A0475-200ul
Manufacturer	Abclonal
Amount	200 ul
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category	Oncology Antibodies By Cell Type Hematology Leukemia Immunohistochemistry Western Blot Primary Antibodies
Type	Antibody Polyclonal
Applications	WB
Specific against	Human (Homo sapiens)
Host	Rabbit
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Protein Family	Lymphocyte Signaling
NCBI	GATA1
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	GF1,GF-1,NFE1,XLTT,ERYF1,NF-E1,XLANP,XLTDA,GATA-1,HAEADA,GATA1
Similar products	GATA-1
Shipping Condition	Cool pack
Available
Manufacturer - Category	Polyclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Protein Weight	43kDa
Background	This gene encodes a protein which belongs to the GATA family of transcription factors. The protein plays an important role in erythroid development by regulating the switch of fetal hemoglobin to adult hemoglobin. Mutations in this gene have been associated with X-linked dyserythropoietic anemia and thrombocytopenia.
Manufacturer - Cross Reactivity	Mouse
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 55-155 of human GATA1 (NP_002040.1).
Recommended Dilution	WB, 1:500 - 1:2000
Protein Size	43kDa
Route	Synthetic peptide
Manufacturer - Research Area	Epigenetics Nuclear Signaling, Transcription Factors, Cell Biology Developmental Biology, Stem Cells, Hematopoietic Progenitors.
Antigen Seq	AAAAALAYYRDAEAYRHSPVFQVYPLLNCMEGIPGGSPYAGWAYGKTGLYPASTVCPTREDSPPQAVEDLDGKGSTSFLETLKTERLSPDLLTLGPALPSS
Manufacturer - Gene ID (Human)	2623
Expected Protein Size	43kDa
Gene Symbol	GATA1

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A0475-200ul-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 200 ul

available

Delivery expected until 11/27/2025

Compare

Add to wishlist

Get an offer

Request delivery time