« Back
Home /
IL17RB Rabbit pAb

IL17RB Rabbit pAb

Item no.	A10147-50ul
Manufacturer	Abclonal
Amount	50 ul
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category	Neuroscience Neuroinflammation Antibodies Cell Biology Cell Culture Cytokines Western Blot ELISA Primary Antibodies Immunostaining
Type	Antibody Polyclonal
Applications	WB, ELISA
Specific against	Human (Homo sapiens)
Host	Rabbit
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	REPTVQCGSETGPSPEWMLQHDLIPGDLRDLRVEPVTTSVATGDYSILMNVSWVLRADASIRLLKATKICVTGKSNFQSYSCVRCNYTEAFQTQTRPSGGKWTFSYIGFPVELNTVYFIGAHNIPNANMNEDGPSMSVNFTSPGCLDHIMKYKKKCVKAGSLWDPNITACKKNEETVEVNFTTTPLGNRYMALIQHSTIIGFSQVFEPHQKKQTRASVVIPVTGDSEGATVQLTPYFPTCGSDCIRHKGTVVLCP
NCBI	IL17RB
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	CRL4,EVI27,IL17BR,IL17RH1,IL17RB
Shipping Condition	Cool pack
Available
Manufacturer - Category	Polyclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Protein Weight	56kDa
Background	The protein encoded by this gene is a cytokine receptor. This receptor specifically binds to IL17B and IL17E, but does not bind to IL17 and IL17C. This receptor has been shown to mediate the activation of NF-kappaB and the production of IL8 induced by IL17E. The expression of the rat counterpart of this gene was found to be significantly up-regulated during intestinal inflammation, which suggested the immunoregulatory activity of this receptor.
Manufacturer - Cross Reactivity	Human, Mouse, Rat
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 18-292 of human IL17RB (NP_061195.2).
Recommended Dilution	WB, 1:1000 - 1:4000
Protein Size	56kDa
Route	Recombinant protein
Manufacturer - Research Area	Cancer, Cell Biology Developmental Biology, Cell Cycle, Cell differentiation, Immunology Inflammation, Cytokines, Interleukins, Cell Intrinsic Innate Immunity Signaling Pathway.
Antigen Seq	REPTVQCGSETGPSPEWMLQHDLIPGDLRDLRVEPVTTSVATGDYSILMNVSWVLRADASIRLLKATKICVTGKSNFQSYSCVRCNYTEAFQTQTRPSGGKWTFSYIGFPVELNTVYFIGAHNIPNANMNEDGPSMSVNFTSPGCLDHIMKYKKKCVKAGSLWDPNITACKKNEETVEVNFTTTPLGNRYMALIQHSTIIGFSQVFEPHQKKQTRASVVIPVTGDSEGATVQLTPYFPTCGSDCIRHKGTVVLCPQTGVPFPLDNNKSKPGGWLP
Manufacturer - Gene ID (Human)	55540
Expected Protein Size	56kDa
Gene Symbol	IL17RB

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A10147-50ul-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 50 ul

available

Delivery expected until 12/18/2025

Compare

Add to wishlist

Get an offer

Request delivery time