Comparison

PTEN Mouse mAb European Partner

Item no. A11128-100ul
Manufacturer Abclonal
Amount 100 ul
Quantity options 1000 uL 100 ul 200 ul 20 ul 500 uL 50 uL
Category
Type Antibody Monoclonal
Applications WB, ELISA
Specific against Human (Homo sapiens)
Host Mouse
Isotype IgG1 Kappa
Conjugate/Tag Unconjugated
Purity Affinity purification
Sequence PMFSGGTCNPQFVVCQLKVKIYSSNSGPTRREDKFMYFEFPQPLPVCGDIKVEFFHKQNKMLKKDKMFHFWVNTFFIPGPEETSEKVENGSLCDQEIDSICSIERADNDKEYLVLTLTKNDLDKANKDKANRYFSPNFKVKLYFTKTVEEPSNPEASSSTSVTPDVSDNEPDHYRYSDTTDSDPENEPFDEDQHTQITKV
NCBI PTEN
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Alias BZS,DEC,CWS1,GLM2,MHAM,TEP1,MMAC1,PTEN1,10q23del,PTENbeta,PTEN
Shipping Condition Cool pack
Available
Manufacturer - Category
Monoclonal Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Protein Weight
47kDa
Background
This gene was identified as a tumor suppressor that is mutated in a large number of cancers at high frequency. The protein encoded by this gene is a phosphatidylinositol-3, 4, 5-trisphosphate 3-phosphatase. It contains a tensin like domain as well as a catalytic domain similar to that of the dual specificity protein tyrosine phosphatases. Unlike most of the protein tyrosine phosphatases, this protein preferentially dephosphorylates phosphoinositide substrates. It negatively regulates intracellular levels of phosphatidylinositol-3, 4, 5-trisphosphate in cells and functions as a tumor suppressor by negatively regulating AKT/PKB signaling pathway. The use of a non-canonical (CUG) upstream initiation site produces a longer isoform that initiates translation with a leucine, and is thought to be preferentially associated with the mitochondrial inner membrane. This longer isoform may help regulate energy metabolism in the mitochondria. A pseudogene of this gene is found on chromosome 9. Alternative splicing and the use of multiple translation start codons results in multiple transcript variants encoding different isoforms.
Manufacturer - Cross Reactivity
Human, Mouse, Rat
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 204-403 of human PTEN (P60484).
Recommended Dilution
WB, 1:500 - 1:1000
Protein Size
47kDa
Route
Recombinant protein
Manufacturer - Research Area
Epigenetics Nuclear Signaling, Translation Control, Regulation of eIF4 and p70 S6 Kinase, Protein phosphorylation, Cancer, Tumor suppressors, Signal Transduction, Kinase, PI3K-Akt Signaling Pathway, mTOR Signaling Pathway, Cell Biology Developmental Biology, Apoptosis, Inhibition of Apoptosis, Cell Cycle, Microtubules, Endocrine Metabolism, Lipid Metabolism, Insulin Receptor Signaling Pathway, Endocrine and metabolic diseases, Diabetes, Obesity, Immunology Inflammation, Cytokines, B Cell Receptor Signaling Pathway, Cardiovascular, Angiogenesis.
Antigen Seq
PMFSGGTCNPQFVVCQLKVKIYSSNSGPTRREDKFMYFEFPQPLPVCGDIKVEFFHKQNKMLKKDKMFHFWVNTFFIPGPEETSEKVENGSLCDQEIDSICSIERADNDKEYLVLTLTKNDLDKANKDKANRYFSPNFKVKLYFTKTVEEPSNPEASSSTSVTPDVSDNEPDHYRYSDTTDSDPENEPFDEDQHTQITKV
Manufacturer - Gene ID (Human)
5728
Expected Protein Size
47kDa
Gene Symbol
PTEN

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ul
Available: In stock
available

Delivery expected until 12/18/2025 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close