Comparison

MTCO2 Rabbit pAb European Partner

Item no. A11154-20ul
Manufacturer Abclonal
Amount 20 ul
Quantity options 1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category
Type Antibody Polyclonal
Applications WB, IF, ICC, ELISA, IHC-P
Specific against Mouse (Murine, Mus musculus)
Host Rabbit
Isotype IgG
Conjugate/Tag Unconjugated
Purity Affinity purification
Sequence GHQWYWSYEYTDYEDLCFDSYMIPTNDLKPGELRLLEVDNRVVLPMELPIRMLISSEDVLHSWAVPSLGLKTDAIPGRLNQATVTSNRPGLFYGQCSEIC
NCBI mt-Co2
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias COX2,MTCO2
Shipping Condition Cool pack
Available
Manufacturer - Category
Polyclonal Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Background
Predicted to enable copper ion binding activity and oxidoreductase activity. Predicted to contribute to cytochrome-c oxidase activity. Predicted to be involved in ATP synthesis coupled electron transport; positive regulation of cellular biosynthetic process; and positive regulation of necrotic cell death. Located in mitochondrion. Is expressed in embryo; epiblast; heart; liver; and metanephros. Orthologous to several human genes including MTCO2P12 (MT-CO2 pseudogene 12).
Manufacturer - Cross Reactivity
Human, Mouse, Rat
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 101-200 of mouse MTCO2 (NP_904331.1).
Recommended Dilution
WB, 1:500 - 1:2000|IHC-P, 1:100 - 1:500|IF/ICC, 1:50 - 1:200
Protein Size
26kDa
Route
Synthetic peptide
Manufacturer - Research Area
Cancer, Signal Transduction, Endocrine & Metabolism, Mitochondrial metabolism, Cytochromes, Mitochondrial markers, Oxidative phosphorylation, Neuroscience, Neurodegenerative Diseases

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 20 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close