« Back
Home /
TRADD Rabbit pAb

TRADD Rabbit pAb

Item no.	A1145-20ul
Manufacturer	Abclonal
Amount	20 ul
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category	Antibodies Cell Biology Cell Status Apoptosis Immunohistochemistry Western Blot ELISA Primary Antibodies Immunostaining
Type	Antibody Polyclonal
Applications	WB, ELISA
Specific against	Human (Homo sapiens)
Host	Rabbit
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	AQTFLFQGQPVVNRPLSLKDQQTFARSVGLKWRKVGRSLQRGCRALRDPALDSLAYEYEREGLYEQAFQLLRRFVQAEGRRATLQRLVEALEENELTSLAEDLLGLTDPNGGLA
NCBI	Tradd
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	9130005N23Rik,TRADD
Shipping Condition	Cool pack
Available
Manufacturer - Category	Polyclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Protein Weight	34kDa
Background	Predicted to enable death domain binding activity; identical protein binding activity; and signaling receptor binding activity. Involved in positive regulation of hair follicle development. Acts upstream of or within extrinsic apoptotic signaling pathway. Located in cytoplasm. Is expressed in adrenal gland; genitourinary system; liver; lung; and spleen. Orthologous to human TRADD (TNFRSF1A associated via death domain).
Manufacturer - Cross Reactivity	Human, Mouse
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 199-312 of human TRADD (NP_003780.1).
Recommended Dilution	WB, 1:1000 - 1:5000
Protein Size	34kDa
Route	Recombinant protein
Manufacturer - Research Area	Cancer, Invasion and Metastasis, Signal Transduction, MAPK-JNK Signaling Pathway, MAPK-P38 Signaling Pathway, Cell Biology & Developmental Biology, Apoptosis, Death receptors & ligands, Inhibition of Apoptosis, Growth factor, TNF, Death Receptor Signaling Pathway, Immunology & Inflammation, NF-kB Signaling Pathway, Cardiovascular.
Antigen Seq	AQTFLFQGQPVVNRPLSLKDQQTFARSVGLKWRKVGRSLQRGCRALRDPALDSLAYEYEREGLYEQAFQLLRRFVQAEGRRATLQRLVEALEENELTSLAEDLLGLTDPNGGLA
Manufacturer - Gene ID (Human)	8717
Expected Protein Size	34kDa
Gene Symbol	Tradd

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A1145-20ul-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 20 ul

available

Delivery expected until 12/25/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer