« Back
Home /
BTK Rabbit pAb

BTK Rabbit pAb

Item no.	A1576-100ul
Manufacturer	Abclonal
Amount	100 ul
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category	Oncology Antibodies Immunohistochemistry Western Blot ELISA Immunofluorescence Primary Antibodies By Organ Lung Cancer Colorectal Cancer Immunostaining
Type	Antibody Polyclonal
Applications	WB, ELISA, IHC-P
Specific against	Human (Homo sapiens)
Host	Rabbit
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	FLLTVHKLSYYEYDFERGRRGSKKGSIDVEKITCVETVVPEKNPPPERQIPRRGEESSEMEQISIIERFPYPFQVVYDEGPLYVFSPTEELRKRWIHQLKNVIRYNSDLVQKYHPCFWIDGQYLCCSQTAKNAMGCQILENRNGSLKPGSSHRKTKKPLPPTPEEDQILKKPLPPEPAAAPVSTSELKKVVALYDYMPMNANDLQLRKGDE
NCBI	BTK
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	AT,ATK,BPK,XLA,IMD1,AGMX1,IGHD3,PSCTK1,BTK
Similar products	BTK
Shipping Condition	Cool pack
Available
Manufacturer - Category	Polyclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Protein Weight	76kDa
Background	The protein encoded by this gene plays a crucial role in B-cell development. Mutations in this gene cause X-linked agammaglobulinemia type 1, which is an immunodeficiency characterized by the failure to produce mature B lymphocytes, and associated with a failure of Ig heavy chain rearrangement. Alternative splicing results in multiple transcript variants encoding different isoforms.
Manufacturer - Cross Reactivity	Human, Mouse, Rat
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 30-240 of human BTK (NP_000052.1).
Recommended Dilution	WB, 1:500 - 1:2000\|IHC-P, 1:50 - 1:100
Protein Size	76kDa
Route	Recombinant protein
Manufacturer - Research Area	Protein phosphorylation, Signal Transduction, Kinase, Tyrosine kinases, Cell Biology Developmental Biology, Apoptosis, Immunology Inflammation, B Cell Receptor Signaling Pathway, Toll-like Receptor Signaling Pathway, Cell Intrinsic Innate Immunity Signaling Pathway, TLR Signaling.
Antigen Seq	FLLTVHKLSYYEYDFERGRRGSKKGSIDVEKITCVETVVPEKNPPPERQIPRRGEESSEMEQISIIERFPYPFQVVYDEGPLYVFSPTEELRKRWIHQLKNVIRYNSDLVQKYHPCFWIDGQYLCCSQTAKNAMGCQILENRNGSLKPGSSHRKTKKPLPPTPEEDQILKKPLPPEPAAAPVSTSELKKVVALYDYMPMNANDLQLRKGDE
Manufacturer - Gene ID (Human)	695
Expected Protein Size	76kDa
Gene Symbol	BTK

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A1576-100ul-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ul

available

Delivery expected until 12/25/2025

Express Delivery: Save 6 days

Compare

Add to wishlist

Get an offer