« Back
Home /
CREB3L3 Rabbit pAb

CREB3L3 Rabbit pAb

Item no.	A16655-100ul
Manufacturer	Abclonal
Amount	100 ul
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category	Neuroscience Molecular Targets for Neuroscience Neural Signaling Antibodies Western Blot ELISA Primary Antibodies Immunostaining
Type	Antibody Polyclonal
Applications	WB, ELISA
Specific against	Human (Homo sapiens)
Host	Rabbit
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	AADAVPGSEAPGPRPEADTTREESPGSPGADWGFQDTANLTNSTEELDNATLVLRNATEGLGQVALLDWVAPGPSTGSGRAGLEAAGDEL
NCBI	CREB3L3
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	CREBH,HYTG2,CREB-H,HYST1481,CREB3L3
Shipping Condition	Cool pack
Available
Manufacturer - Category	Polyclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Protein Weight	49kDa
Background	This gene encodes a member of the basic-leucine zipper family and the AMP-dependent transcription factor family. The encoded protein is localized to the endoplasmic reticulum and acts as a transcription factor activated by cyclic AMP stimulation. The encoded protein binds the cyclic AMP response element (CRE) and the box-B element and has been linked to acute inflammatory response, hepatocellular carcinoma, triglyceride metabolism, and hepcidin expression. Alternative splicing results in multiple transcript variants.
Manufacturer - Cross Reactivity	Human, Rat
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 371-460 of human CREB3L3 (NP_001258924.1).
Recommended Dilution	WB, 1:500 - 1:1000
Protein Size	49kDa
Route	Recombinant Protein
Manufacturer - Research Area	Epigenetics Nuclear Signaling, Transcription Factors, Neuroscience, Neurodegenerative Diseases.
Antigen Seq	AADAVPGSEAPGPRPEADTTREESPGSPGADWGFQDTANLTNSTEELDNATLVLRNATEGLGQVALLDWVAPGPSTGSGRAGLEAAGDEL
Manufacturer - Gene ID (Human)	84699
Expected Protein Size	49kDa
Gene Symbol	CREB3L3

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A16655-100ul-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ul

available

Delivery expected until 12/18/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer