« Back
Home /
[KD Validated] RAB27A Rabbit pAb

[KD Validated] RAB27A Rabbit pAb

Item no.	A1934-50ul
Manufacturer	Abclonal
Amount	50 ul
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category	Antibodies Cell Biology Cytoskeleton Immunohistochemistry Western Blot ELISA Immunofluorescence Immunocytochemistry Primary Antibodies Immunostaining Immunochemistry small GTPases Rab Subfamily
Type	Antibody Polyclonal
Applications	WB, IF, ICC, ELISA
Specific against	Human (Homo sapiens)
Host	Rabbit
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	MSDGDYDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRASGPDGATGRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACGC
NCBI	RAB27A
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	GS2,RAM,RAB27,HsT18676,[KD Validated] RAB27A
Similar products	RAB27A
Shipping Condition	Cool pack
Available
Manufacturer - Category	Polyclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Protein Weight	25kDa
Background	The protein encoded by this gene belongs to the small GTPase superfamily, Rab family. The protein is membrane-bound and may be involved in protein transport and small GTPase mediated signal transduction. Mutations in this gene are associated with Griscelli syndrome type 2. Alternative splicing occurs at this locus and four transcript variants encoding the same protein have been identified.
Manufacturer - Cross Reactivity	Human, Mouse
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-221 of human RAB27A (NP_899057.1).
Recommended Dilution	WB, 1:500 - 1:1000\|IF/ICC, 1:50 - 1:200
Protein Size	25kDa
Route	Recombinant protein
Manufacturer - Research Area	Signal Transduction, G protein signaling, Small G proteins, Cell Biology Developmental Biology, Apoptosis.
Antigen Seq	MSDGDYDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRASGPDGATGRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACGC
Manufacturer - Gene ID (Human)	5873
Expected Protein Size	25kDa
Gene Symbol	RAB27A

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A1934-50ul-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 50 ul

available

Delivery expected until 12/25/2025

Express Delivery: Save 6 days

Compare

Add to wishlist

Get an offer