« Back
Home /
Uhrf2 Rabbit pAb

Uhrf2 Rabbit pAb

Item no.	A2344-100ul
Manufacturer	Abclonal
Amount	100 ul
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category	Oncology Antibodies Immunohistochemistry Western Blot ELISA Immunofluorescence Primary Antibodies By Organ Lung Cancer Colorectal Cancer Immunostaining
Type	Antibody Polyclonal
Applications	WB, ELISA
Specific against	Mouse (Murine, Mus musculus)
Host	Rabbit
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	DSSLPSTSKQNDAQVKPSSHNPPKVKKTARGGSSSQPSTSARTCLIDPGFGLYKVNELVDARDVGLGAWFEAHIHSVTRASDGHSRGKTPLKNGSSYKRTNGNVNHNSKENTNKLDNVPSTSNSDSVAADEDVIYHIEYDEYPESGILEMNVKDLRPRARTILKWNELNVGDVVMVNYNVENPGKRGFWYDAEITTLKTISRTKKEVRVKVFLGGSEGTLNDCRVMSVDEIFKIEKPGAHPISFADGKFLRKNDP
NCBI	Uhrf2
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	Nirf,2310065A22Rik,D130071B19Rik,Uhrf2
Similar products	UHRF2
Shipping Condition	Cool pack
Available
Manufacturer - Category	Polyclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Protein Weight	90kDa
Background	Enables histone binding activity. Predicted to be involved in several processes, including maintenance of DNA methylation; protein autoubiquitination; and regulation of cell cycle. Located in heterochromatin and nucleus. Is expressed in several structures, including central nervous system; ear; early conceptus; female reproductive system; and urinary system. Orthologous to human UHRF2 (ubiquitin like with PHD and ring finger domains 2).
Manufacturer - Cross Reactivity	Human, Mouse, Rat
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 76-359 of mouse Uhrf2 (NP_659122.2).
Recommended Dilution	WB, 1:500 - 1:1000
Protein Size	90kDa
Route	Recombinant protein
Manufacturer - Research Area	Cell Biology & Developmental Biology, Apoptosis, Cell Cycle, Cell cycle inhibitors, Ubiquitin.
Antigen Seq	DSSLPSTSKQNDAQVKPSSHNPPKVKKTARGGSSSQPSTSARTCLIDPGFGLYKVNELVDARDVGLGAWFEAHIHSVTRASDGHSRGKTPLKNGSSYKRTNGNVNHNSKENTNKLDNVPSTSNSDSVAADEDVIYHIEYDEYPESGILEMNVKDLRPRARTILKWNELNVGDVVMVNYNVENPGKRGFWYDAEITTLKTISRTKKEVRVKVFLGGSEGTLNDCRVMSVDEIFKIEKPGAHPISFADGKFLRKNDPECDLCGGDPDKTCHMCSCHKCGEKRDPNM
Manufacturer - Gene ID (Human)	115426
Expected Protein Size	90kDa
Gene Symbol	Uhrf2

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A2344-100ul-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ul

available

Delivery expected until 12/25/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer