Comparison

Asymmetric DiMethyl-Histone H3-R17 Rabbit pAb European Partner

Item no. A2421-100ul
Manufacturer Abclonal
Amount 100 ul
Quantity options 1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category
Type Antibody Polyclonal
Applications WB, IF, ICC, ELISA
Specific against Human (Homo sapiens)
Host Rabbit
Isotype IgG
Conjugate/Tag Unconjugated
Purity Affinity purification
Sequence ARTKQTARKSTGGKAPRKQLA
NCBI H3C12
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias H3/j,H3C1,H3C2,H3C3,H3C4,H3C6,H3C7,H3C8,H3FJ,H3C10,H3C11,HIST1H3J,Asymmetric DiMethyl-Histone H3-R17
Similar products Histone H3R17me2a
Shipping Condition Cool pack
Available
Manufacturer - Category
Methylated Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Protein Weight
15kDa
Background
Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H3 family. Transcripts from this gene lack polyA tails but instead contain a palindromic termination element. This gene is found in the small histone gene cluster on chromosome 6p22-p21.3.
Manufacturer - Cross Reactivity
Human, Mouse, Rat, Other (Wide Range Predicted)
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human histone H3 (NP_003520.1).
Recommended Dilution
WB, 1:500 - 1:1000|IF/ICC, 1:50 - 1:200|IP, 1:50 - 1:200
Protein Size
15kDa
Route
Synthetic peptide
Manufacturer - Research Area
Epigenetics & Nuclear Signaling, Epigenetic Modifications, Methylation, Epigenetics & Nuclear Signaling, Epigenetic Modifications, Methylation, Epigenetics & Nuclear Signaling, Epigenetic Modifications, Methylation.
Antigen Seq
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY
Manufacturer - Gene ID (Human)
H3
Expected Protein Size
15kDa
Gene Symbol
H3C12

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close