« Back
Home /
FST Rabbit pAb

FST Rabbit pAb

Item no.	A2936-100ul
Manufacturer	Abclonal
Amount	100 ul
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category	Oncology Antibodies Western Blot Primary Antibodies By Organ Uterine, Ovarian & Cervical Cancer
Type	Antibody Polyclonal
Applications	WB, ELISA
Specific against	Human (Homo sapiens)
Host	Rabbit
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	AACSSGVLLEVKHSGSCNSISEDTEEEEEDEDQDYSFPISSILEW
NCBI	FST
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	FS,FST
Similar products	FST
Shipping Condition	Cool pack
Available
Manufacturer - Category	Polyclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Protein Weight	38kDa
Background	Follistatin is a single-chain gonadal protein that specifically inhibits follicle-stimulating hormone release. The single FST gene encodes two isoforms, FST317 and FST344 containing 317 and 344 amino acids respectively, resulting from alternative splicing of the precursor mRNA. In a study in which 37 candidate genes were tested for linkage and association with polycystic ovary syndrome (PCOS) or hyperandrogenemia in 150 families, evidence was found for linkage between PCOS and follistatin.
Manufacturer - Cross Reactivity	Human, Rat
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 300-400 of human FST (P19883).
Recommended Dilution	WB, 1:100 - 1:500
Protein Size	38kDa
Route	Synthetic peptide
Manufacturer - Research Area	Epigenetics Nuclear Signaling, Signal Transduction, Cell Biology Developmental Biology, Growth factors.
Antigen Seq	AACSSGVLLEVKHSGSCNSISEDTEEEEEDEDQDYSFPISSILEW
Manufacturer - Gene ID (Human)	10468
Expected Protein Size	38kDa
Gene Symbol	FST

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A2936-100ul-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ul

available

Delivery expected until 10/9/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer