« Back
Home /
FABP1 Rabbit pAb

FABP1 Rabbit pAb

Item no.	A5311-20ul
Manufacturer	Abclonal
Amount	20 ul
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category	Antibodies Immunohistochemistry Western Blot Immunofluorescence Primary Antibodies
Type	Antibody Polyclonal
Applications	WB, IF, ICC, ELISA
Specific against	Human (Homo sapiens)
Host	Rabbit
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI
NCBI	FABP1
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	FABPL,L-FABP,FABP1
Shipping Condition	Cool pack
Available
Manufacturer - Category	Polyclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Protein Weight	14kDa
Background	This gene encodes the fatty acid binding protein found in liver. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. This protein and FABP6 (the ileal fatty acid binding protein) are also able to bind bile acids. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism.
Manufacturer - Cross Reactivity	Human, Mouse, Rat
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-127 of human FABP1 (NP_001434.1).
Recommended Dilution	WB, 1:2000 - 1:6000\|IF/ICC, 1:50 - 1:200
Protein Size	14kDa
Route	Recombinant protein
Manufacturer - Research Area	Cancer, Signal Transduction, Endocrine Metabolism, Lipid Metabolism.
Antigen Seq	MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI
Manufacturer - Gene ID (Human)	2168
Expected Protein Size	14kDa
Gene Symbol	FABP1

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A5311-20ul-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 20 ul

available

Delivery expected until 10/2/2025

Compare

Add to wishlist

Get an offer

Request delivery time