« Back
Home /
GRB7 Rabbit pAb

GRB7 Rabbit pAb

Item no.	A5690-100ul
Manufacturer	Abclonal
Amount	100 ul
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category	Oncology Antibodies Immunohistochemistry Western Blot Primary Antibodies By Organ Bladder Cancer
Type	Antibody Polyclonal
Applications	WB, ELISA
Specific against	Human (Homo sapiens)
Host	Rabbit
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	MELDLSPPHLSSSPEDLCPAPGTPPGTPRPPDTPLPEEVKRSQPLLIPTTGRKLREEERRATSLPSIPNPFPELCSPPSQSPILGGPSSARGLLPRDASRPHVVKVYSEDGACRSVEVAAGATARHVCEMLVQRAHALSD
NCBI	GRB7
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	GRB7
Similar products	GRB7
Shipping Condition	Cool pack
Available
Manufacturer - Category	Polyclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Protein Weight	60kDa
Background	The product of this gene belongs to a small family of adapter proteins that are known to interact with a number of receptor tyrosine kinases and signaling molecules. This gene encodes a growth factor receptor-binding protein that interacts with epidermal growth factor receptor (EGFR) and ephrin receptors. The protein plays a role in the integrin signaling pathway and cell migration by binding with focal adhesion kinase (FAK). Several transcript variants encoding two different isoforms have been found for this gene.
Manufacturer - Cross Reactivity	Human
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human GRB7 (NP_001229372.1).
Recommended Dilution	WB, 1:500 - 1:2000
Protein Size	60kDa
Route	Recombinant protein
Manufacturer - Research Area	Signal Transduction.
Antigen Seq	MELDLSPPHLSSSPEDLCPAPGTPPGTPRPPDTPLPEEVKRSQPLLIPTTGRKLREEERRATSLPSIPNPFPELCSPPSQSPILGGPSSARGLLPRDASRPHVVKVYSEDGACRSVEVAAGATARHVCEMLVQRAHALSD
Manufacturer - Gene ID (Human)	2886
Expected Protein Size	60kDa
Gene Symbol	GRB7

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A5690-100ul-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ul

available

Delivery expected until 10/9/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer