« Back
Home /
SOX14 Rabbit pAb

SOX14 Rabbit pAb

Item no.	A7217-50ul
Manufacturer	Abclonal
Amount	50 ul
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category	Oncology Antibodies Immunohistochemistry Western Blot Immunofluorescence Primary Antibodies By Organ Testicular & Prostate Cancer
Type	Antibody Polyclonal
Applications	WB, ELISA
Specific against	Human (Homo sapiens)
Host	Rabbit
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	RYVFPLPYLGDTDPLKAAGLPVGASDGLLSAPEKARAFLPPASAPYSLLDPAQFSSSAIQKMGEVPHTLATGALPYASTLGYQNGAFGSLSCPSQHTHTHPSPTNPGYVVPCNCTAWSASTLQPPVAYILFPGMTKTGIDPYSSAHATAM
NCBI	SOX14
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	SOX28, SOX14
Shipping Condition	Cool pack
Available
Manufacturer - Category	Polyclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Availability	Inquiry before order
Background	This intronless gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. Mutations in this gene are suggested to be responsible for the limb defects associated with blepharophimosis, ptosis, epicanthus inversus syndrome (BPES) and Mobius syndrome.
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 91-240 of human SOX14 (NP_004180.1).
Recommended Dilution	WB, 1:500 - 1:2000
Protein Size	26kDa
Route	Recombinant protein
Manufacturer - Research Area	Epigenetics Nuclear Signaling, Transcription Factors, Signal Transduction, Neuroscience

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A7217-50ul-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 50 ul

available

Delivery expected until 8/28/2025

Compare

Add to wishlist

Get an offer

Request delivery time