« Back
Home /
RAB5B Rabbit pAb

RAB5B Rabbit pAb

Item no.	A7447-50ul
Manufacturer	Abclonal
Amount	50 ul
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category	Antibodies Cell Biology Cytoskeleton Immunohistochemistry Western Blot ELISA Immunofluorescence Immunocytochemistry Primary Antibodies Immunostaining Immunochemistry small GTPases Rab Subfamily
Type	Antibody Polyclonal
Applications	WB, IF, ICC, ELISA
Specific against	Human (Homo sapiens)
Host	Rabbit
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	YDITNQETFARAKTWVKELQRQASPSIVIALAGNKADLANKRMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKKLPKSEPQNLGGAAGRSRGVD
NCBI	RAB5B
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	RAB5B
Shipping Condition	Cool pack
Available
Manufacturer - Category	Polyclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3.
Protein Weight	24kDa
Background	Enables GDP binding activity; GTP-dependent protein binding activity; and GTPase activity. Involved in antigen processing and presentation and plasma membrane to endosome transport. Located in endosome and extracellular exosome.
Manufacturer - Cross Reactivity	Human, Mouse, Rat
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 100-200 of human RAB5B (NP_002859.1).
Recommended Dilution	WB, 1:500 - 1:2000\|IF/ICC, 1:50 - 1:200
Protein Size	24kDa
Route	Synthetic peptide
Manufacturer - Research Area	Signal Transduction, G protein signaling, Small G proteins, Neuroscience, Neurodegenerative Diseases, Dopamine Signaling in Parkinson's Disease.
Antigen Seq	YDITNQETFARAKTWVKELQRQASPSIVIALAGNKADLANKRMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKKLPKSEPQNLGGAAGRSRGVD
Manufacturer - Gene ID (Human)	5869
Expected Protein Size	24kDa
Gene Symbol	RAB5B

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A7447-50ul-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 50 ul

available

Delivery expected until 12/25/2025

Express Delivery: Save 6 days

Compare

Add to wishlist

Get an offer