Item no. |
A7692-100ul |
Manufacturer |
Abclonal
|
Amount |
100 ul |
Quantity options |
1000 uL
100 ul
200 ul
20 ul
500 uL
50 ul
|
Category |
|
Type |
Antibody Polyclonal |
Applications |
WB, IF, ICC, ELISA, IHC-P |
Specific against |
Human (Homo sapiens) |
Host |
Rabbit |
Isotype |
IgG |
Conjugate/Tag |
Unconjugated |
Purity |
Affinity purification |
Sequence |
PALSPCAVSSTLPDWHIPVEVVPDSTSDLYNFQVSPMPSTSEATTDEDEEGKLPEDIMKLLEQSEWQPTNVDGKGYLLNEPGVQPTSVYGDFSCKEEPEI |
NCBI |
IRF1 |
ECLASS 10.1 |
32160702 |
ECLASS 11.0 |
32160702 |
UNSPSC |
12352203 |
Alias |
MAR, IRF-1, IRF1 |
Shipping condition |
Cool pack |
Available |
|
Manufacturer - Category |
Polyclonal Antibodies |
Shipping Temperature |
ice pack |
Storage Conditions |
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Background |
The protein encoded by this gene is a transcriptional regulator and tumor suppressor, serving as an activator of genes involved in both innate and acquired immune responses. The encoded protein activates the transcription of genes involved in the body's response to viruses and bacteria, playing a role in cell proliferation, apoptosis, the immune response, and DNA damage response. This protein represses the transcription of several other genes. As a tumor suppressor, it both suppresses tumor cell growth and stimulates an immune response against tumor cells. Defects in this gene have been associated with gastric cancer, myelogenous leukemia, and lung cancer. |
Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 181-280 of human IRF1 (NP_002189.1). |
Recommended Dilution |
WB, 1:500 - 1:1000|IHC-P, 1:50 - 1:100|IF/ICC, 1:50 - 1:100 |
Protein Size |
37kDa |
Route |
Synthetic peptide |
Manufacturer - Research Area |
Epigenetics Nuclear Signaling, Transcription Factors, Cell Biology Developmental Biology, Apoptosis, Cardiovascular |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.