Comparison

CX3CL1 Rabbit pAb European Partner

Item no. A14198-100ul
Manufacturer Abclonal
Amount 100 ul
Quantity options 1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category
Type Antibody Polyclonal
Applications WB, IF, ICC, ELISA, IHC-P
Specific against Human (Homo sapiens)
Host Rabbit
Isotype IgG
Conjugate/Tag Unconjugated
Purity Affinity purification
Sequence LQGCPRKMAGEMAEGLRYIPRSCGSNSYVLVPV
NCBI CX3CL1
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias NTN,NTT,CXC3,CXC3C,SCYD1,ABCD-3,C3Xkine,fractalkine,neurotactin,CX3CL1
Shipping Condition Cool pack
Available
Manufacturer - Category
Polyclonal Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Protein Weight
42kDa
Background
This gene belongs to the CX3C subgroup of chemokines, characterized by the number of amino acids located between the conserved cysteine residues. This is the only member of the CX3C subgroup, which contains three amino acids between cysteine residues, resulting in a Cys-X-X-X-Cys configuration. The encoded protein contains an extended mucin-like stalk with a chemokine domain on top, and exists in both a membrane-anchored form where it acts as a binding molecule, or, in soluble form, as a chemotactic cytokine. The mature form of this protein can be cleaved at the cell surface, yielding different soluble forms that can interact with the G-protein coupled receptor, C-X3-C motif chemokine receptor 1 gene product. This gene plays a role in a wide range of diseases, including cancer, vasculitis, neuropathies, atherosclerosis, inflammatory diseases, and in human immunodeficiency virus infections.
Manufacturer - Cross Reactivity
Human, Mouse, Rat
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 365-397 of human CX3CL1 (NP_002987.1).
Recommended Dilution
WB, 1:500 - 1:1000|IHC-P, 1:50 - 1:200|IF/ICC, 1:50 - 1:200
Protein Size
42kDa
Route
Recombinant protein
Manufacturer - Research Area
Immunology Inflammation, Cytokines, Cell Intrinsic Innate Immunity Signaling Pathway, Cardiovascular.
Antigen Seq
LQGCPRKMAGEMAEGLRYIPRSCGSNSYVLVPV
Manufacturer - Gene ID (Human)
6376
Expected Protein Size
42kDa
Gene Symbol
CX3CL1

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close