« Back
Home /
USO1 Rabbit pAb

USO1 Rabbit pAb

Item no.	A16079-200ul
Manufacturer	Abclonal
Amount	200 ul
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category	Antibodies Western Blot Immunofluorescence Primary Antibodies
Type	Antibody Polyclonal
Applications	WB, IF, ICC, ELISA
Specific against	Human (Homo sapiens)
Host	Rabbit
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	DLQLEELRQQVSTLKCQNEQLQTAVTQQVSQIQQHKDQYNLLKIQLGKDNQHQGSYSEGAQMNGIQPEEIGRLREEIEELKRNQELLQSQLTEKDSMIENMKSSQTSGTNEQSSAIVSARDSEQVAELKQELATLKSQLNSQSVEITKLQTEKQELLQKTEAFAKSVEVQGETETIIATKTTDVEGRLSALLQETKELKNEIKALSEERTAIKEQLDSSNSTIAILQTEKDKLELEITDSKKEQDDLLVLLADQD
NCBI	USO1
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	TAP, VDP, P115, USO1
Shipping Condition	Cool pack
Available
Manufacturer - Category	Polyclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Background	The protein encoded by this gene is a peripheral membrane protein which recycles between the cytosol and the Golgi apparatus during interphase. It is regulated by phosphorylation: dephosphorylated protein associates with the Golgi membrane and dissociates from the membrane upon phosphorylation. Ras-associated protein 1 recruits this protein to coat protein complex II (COPII) vesicles during budding from the endoplasmic reticulum, where it interacts with a set of COPII vesicle-associated SNAREs to form a cis-SNARE complex that promotes targeting to the Golgi apparatus. Alternative splicing results in multiple transcript variants.
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 663-962 of human USO1 (NP_003706.2).
Recommended Dilution	WB, 1:500 - 1:2000\|IF/ICC, 1:50 - 1:100
Protein Size	108kDa
Route	Recombinant Protein
Manufacturer - Research Area	Epigenetics Nuclear Signaling, RNA Binding, Signal Transduction

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A16079-200ul-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 200 ul

available

Delivery expected until 9/4/2025

Compare

Add to wishlist

Get an offer

Request delivery time