Comparison

TEAD1 Rabbit pAb European Partner

Item no. A6768-100ul
Manufacturer Abclonal
Amount 100 ul
Quantity options 1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category
Type Antibody Polyclonal
Applications WB, IF, IP, ICC, ELISA, IHC-P, CHIP
Specific against Human (Homo sapiens)
Host Rabbit
Isotype IgG
Conjugate/Tag Unconjugated
Purity Affinity purification
Sequence AIHNKLGLPGIPRPTFPGAPGFWPGMIQTGQPGSSQDVKPFVQQAYPIQPAVTAPIPGFEPASAPAPSVPAWQGRSIGTTK
NCBI TEAD1
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias AA, REF1, TCF13, TEF-1, NTEF-1, TCF-13, TEAD-1, TEAD1
Shipping Condition Cool pack
Available
Manufacturer - Category
Polyclonal Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Background
This gene encodes a ubiquitous transcriptional enhancer factor that is a member of the TEA/ATTS domain family. This protein directs the transactivation of a wide variety of genes and, in placental cells, also acts as a transcriptional repressor. Mutations in this gene cause Sveinsson's chorioretinal atrophy. Additional transcript variants have been described but their full-length natures have not been experimentally verified.
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 135-215 of human TEAD1 (NP_068780.2).
Recommended Dilution
WB, 1:100 - 1:500|IHC-P, 1:50 - 1:200|IF/ICC, 1:50 - 1:200|ChIP, 1:50 - 1:200
Protein Size
48kDa
Route
Recombinant protein
Manufacturer - Research Area
Epigenetics Nuclear Signaling, Transcription Factors, Cell Biology Developmental Biology, Cell Adhesion, Wnt ��-Catenin Signaling Pathway, Cardiovascular, Heart, Cardiogenesis

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close