« Back
Home /
DDX53 Rabbit pAb

DDX53 Rabbit pAb

Item no.	A14973-20ul
Manufacturer	Abclonal
Amount	20 ul
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category	Antibodies Immunohistochemistry Primary Antibodies
Type	Antibody Polyclonal
Applications	ELISA, IHC-P
Specific against	Human (Homo sapiens)
Host	Rabbit
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	MSHWAPEWKRAEANPRDLGASWDVRGSRGSGWSGPFGHQGPRAAGSREPPLCFKIKNNMVGVVIGYSGSKIKDLQHSTNTKIQIINGESEAKVRIFGNREMKAKAKAAIETLIRKQESYNSESSVDNAASQTPIGRNLGRNDIVGEAEPLSNWDRIRAAV
NCBI	DDX53
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	CAGE,CT26,DDX53
Shipping Condition	Cool pack
Available
Manufacturer - Category	Polyclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Availability	Inquiry before order
Background	This intronless gene encodes a protein which contains several domains found in members of the DEAD-box helicase protein family. Other members of this protein family participate in ATP-dependent RNA unwinding.
Manufacturer - Cross Reactivity	Mouse
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human DDX53 (NP_874358.2).
Recommended Dilution	IHC-P, 1:50 - 1:200
Protein Size	71kDa
Route	Recombinant Protein
Manufacturer - Research Area	Epigenetics Nuclear Signaling, Transcription Factors, Cancer, Tumor biomarkers

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A14973-20ul-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 20 ul

available

Delivery expected until 10/2/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer