« Back
Home /
RHOU Rabbit pAb

RHOU Rabbit pAb

Item no.	A17195-50ul
Manufacturer	Abclonal
Amount	50 ul
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category	Antibodies Cell Biology Cytoskeleton Western Blot ELISA Primary Antibodies Immunostaining small GTPases Rho Subfamily
Type	Antibody Polyclonal
Applications	WB, ELISA
Specific against	Human (Homo sapiens)
Host	Rabbit
Isotype	IgG
Purity	Affinity purification
Sequence	GRAGGAEGRGVKCVLVGDGAVGKTSLVVSYTTNGYPTEYIPTAFDNFSAVVSVDGRPVRLQ
NCBI	RHOU
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	ARHU,G28K,WRCH1,hG28K,CDC42L1,RHOU
Shipping Condition	Cool pack
Available
Manufacturer - Category	Polyclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Protein Weight	28kDa
Background	This gene encodes a member of the Rho family of GTPases. This protein can activate PAK1 and JNK1, and can induce filopodium formation and stress fiber dissolution. It may also mediate the effects of WNT1 signaling in the regulation of cell morphology, cytoskeletal organization, and cell proliferation. A non-coding transcript variant of this gene results from naturally occurring read-through transcription between this locus and the neighboring DUSP5P (dual specificity phosphatase 5 pseudogene) locus.
Manufacturer - Cross Reactivity	Mouse
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 40-100 of human RHOU (NP_067028.1).
Recommended Dilution	WB, 1:500 - 1:2000
Protein Size	28kDa
Route	Synthetic Peptide
Manufacturer - Research Area	Signal Transduction, G protein signaling, Small G proteins, MAPK-JNK Signaling Pathway.
Antigen Seq	GRAGGAEGRGVKCVLVGDGAVGKTSLVVSYTTNGYPTEYIPTAFDNFSAVVSVDGRPVRLQ
Manufacturer - Gene ID (Human)	58480
Expected Protein Size	28kDa
Gene Symbol	RHOU

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A17195-50ul-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 50 ul

available

Delivery expected until 12/25/2025

Express Delivery: Save 6 days

Compare

Add to wishlist

Get an offer