Comparison

Icam5 Rabbit pAb European Partner

Item no. A15732-200ul
Manufacturer Abclonal
Amount 200 ul
Quantity options 1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category
Type Antibody Polyclonal
Applications WB, ELISA
Specific against Mouse (Murine, Mus musculus)
Host Rabbit
Isotype IgG
Conjugate/Tag Unconjugated
Purity Affinity purification
Sequence VEGSGKLFSCEVDGKPEPRVECVGSEGASEGIVLPLVSSNSGPRNSMTPGNLSPGIYLCNATNRHGSTVKTVVVSAESPPQMDESSCPSHQTWLEGAEATALACSARGRPSPRVHCSREGAARLERLQVSREDAGTYRCVATNAHGTDSRTVTVGVEYRPVVAELAASPPSVRPGGNFTLTCRAEAWPPAQISWRAPPGAL
NCBI Icam5
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias TLN, CD50, Tlcn, Icam3, ICAM-3, ICAM-5, Icam5
Shipping Condition Cool pack
Available
Manufacturer - Category
Polyclonal Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Background
Predicted to enable integrin binding activity. Acts upstream of or within phagocytosis. Located in plasma membrane. Is expressed in brain. Orthologous to human ICAM5 (intercellular adhesion molecule 5).
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 586-786 of mouse Icam5 (NP_032345.2).
Recommended Dilution
WB, 1:500 - 1:2000
Protein Size
97kDa
Route
Recombinant Protein
Manufacturer - Research Area
Cell Biology & Developmental Biology, Cell Adhesion, Neuroscience, Cell Type Marker

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 200 ul
Available: In stock
available

Delivery expected until 9/4/2025 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close