« Back
Home /
ARHGAP22 Rabbit pAb

ARHGAP22 Rabbit pAb

Item no.	A16566-20ul
Manufacturer	Abclonal
Amount	20 ul
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category	Neuroscience Neural Signaling Antibodies Cell Biology Cytoskeleton Western Blot ELISA Primary Antibodies Immunostaining small GTPases Rho Subfamily
Type	Antibody Polyclonal
Applications	WB, ELISA
Specific against	Human (Homo sapiens)
Host	Rabbit
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	NVPAPGLVPGIPSVASMAWSGASSSESSVGGSLSSCTACRASDSSARSSLHTDWALEPSPLPSSSEDPKSLDLDHSMDEAGAGASNSEPSEPDSPTREHARRSEALQGLVTELRAELCRQRTEYERSVKRIEEGSADLRKR
NCBI	ARHGAP22
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	RhoGAP2,RhoGap22,ARHGAP22
Shipping Condition	Cool pack
Available
Manufacturer - Category	Polyclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Protein Weight	77kDa
Background	This gene encodes a member of the GTPase activating protein family which activates a GTPase belonging to the RAS superfamily of small GTP-binding proteins. The encoded protein is insulin-responsive, is dependent on the kinase Akt and requires the Akt-dependent 14-3-3 binding protein which binds sequentially to two serine residues. The result of these interactions is regulation of cell motility. Multiple transcript variants encoding different isoforms have been found for this gene.
Manufacturer - Cross Reactivity	Mouse, Rat
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 510-650 of human ARHGAP22 (NP_001242953.1).
Recommended Dilution	WB, 1:500 - 1:2000
Protein Size	77kDa
Route	Recombinant Protein
Manufacturer - Research Area	Signal Transduction, G protein signaling, Small G proteins, Cardiovascular, Angiogenesis.
Antigen Seq	NVPAPGLVPGIPSVASMAWSGASSSESSVGGSLSSCTACRASDSSARSSLHTDWALEPSPLPSSSEDPKSLDLDHSMDEAGAGASNSEPSEPDSPTREHARRSEALQGLVTELRAELCRQRTEYERSVKRIEEGSADLRKR
Manufacturer - Gene ID (Human)	58504
Expected Protein Size	77kDa
Gene Symbol	ARHGAP22

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A16566-20ul-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 20 ul

available

Delivery expected until 12/18/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer