Comparison

NOX1 Rabbit pAb European Partner

Item no. A11966-50ul
Manufacturer Abclonal
Amount 50 ul
Quantity options 1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category
Type Antibody Polyclonal
Applications WB, ELISA, IHC-P
Specific against Human (Homo sapiens)
Host Rabbit
Isotype IgG
Conjugate/Tag Unconjugated
Purity Affinity purification
Sequence WYKFQCADHNLKTKKIYFYWICRETGAFSWFNNLLTSLEQEMEELGKVGFLNYRLFLTGWDSNIVGHAALNFDKATDIVTGLKQKTSFGRPMWDNEFSTIATSHPKSVVGVFLCGPRTLAKSLRKCCHRYSSLDPRKVQFYFNKENF
NCBI NOX1
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias MOX1,NOH1,NOH-1,GP91-2,NOH-1L,NOX1
Shipping Condition Cool pack
Available
Manufacturer - Category
Polyclonal Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Background
This gene encodes a member of the NADPH oxidase family of enzymes responsible for the catalytic one-electron transfer of oxygen to generate superoxide or hydrogen peroxide. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Manufacturer - Cross Reactivity
Human, Mouse
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 418-564 of human NOX1 (NP_008983.2?).
Recommended Dilution
WB, 1:200 - 1:500|IHC-P, 1:50 - 1:200
Protein Size
65kDa
Route
Synthetic peptide
Manufacturer - Research Area
Epigenetics Nuclear Signaling, DNA Damage Repair, Cancer, Signal Transduction, Cell Biology Developmental Biology, Endocrine Metabolism, Nucleotide metabolism, Immunology Inflammation

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 50 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close