« Back
Home /
Oct6 (POU3F1) antibody

Oct6 (POU3F1) antibody

Manufacturer	Absea Biotechnology
Category	Antibodies Immunohistochemistry Immunoprecipitation Western Blot Immunocytochemistry Primary Antibodies
Type	Antibody Monoclonal
Specific against	Mouse
Clone	KT110
Isotype	IgG1
Applications	WB, IP, IHC, ICC
Amount	0.1mg
Host	Mouse
Item no.	ASE-060204E04-0.1mg
eClass 6.1	32160702
eClass 9.0	42030590
Available
Swissprot	P21952
Clonality	Monoclonal
GeneID	18991
Uniprot protein name	POU domain, class 3, transcription factor 1 Short name=Oct-6
Uniprot Gene name	Name: Pou3f1 Synonyms: Oct6, Otf-6, Otf6, Scip
Amino Acid Start	2
Amino Acid End	196
Protein Length	195
Sequence	TTAQYLPRGPGGGAGGTGPLMHPDAAAAAAAAAERLHAGAAYREVQKLMHHEWLGAGAGHPVGLAHPQWLPTGGGGGGDWAGGPHLEHGKAGGGGTGRADDGGGGGGFHARLVHQGAAHAGAAWAQGGTAHHLGPAMSPSPGAGGGHQPQPLGLYAQAAYPGGGGGGLAGMLAAGGGGAGPGLHHALHEDGHEAQ

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 0.1mg

available

Delivery expected until 6/6/2024