Secreted Phospholipase A2-X Human Recombinant

Lyophilized powder at room temperature.

Secreted Phospholipase A2-X Human Recombinant is manufactured with N-terminal fusion HisTag. PLA2G10 His-Tagged Fusion Protein, is 15.5 kDa containing 123 amino acid residues of the human secreted phospholipase A2-X and 16 additional amino acid residues - HisTag (underlined).MRGSHHHHHHGMASHMGILELAGTVGCVGPRTPIAYMKYGCFCGLGGHGQPRDAIDWCCHGHDCCYTRAEEAGCSPKTERYSWQCVNQSVLCGPAENKCQELLCKCDQEIANCLAQTEYNLKYLFYPQFLCEPDSPKCD.
Physical Appearance and Stability: Store lyophilized protein at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4C for a limited period of time; it does not show any change after two weeks at 4C.
Formulation and Purity: Sterile filtered and lyophilized from 0.5 mg/ml in 0.01M Tris buffer pH 7.2. Greater than 95% as determined by SDS PAGE.
Solubility: Add 0.2 ml of distilled water and let the lyophilized pellet dissolve completely.