Comparison

Secreted Phospholipase A2-X Human Recombinant

Item no. ANG-rAP-1816-2ug
Manufacturer Angio-Proteomie
Amount 2 ug
Quantity options 1000 ug 10 ug 1 ea 2 ug
Category
Type Proteins Recombinant
Format Lyophilized
Specific against other
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Group 10 secretory phospholipase A2, EC 3.1.1.4, Group X secretory phospholipase A2, Phosphatidylcholine 2-acylhydrolase GX, GX sPLA2, sPLA2-X, SPLA2, GXPLA2, MGC119918, MGC119919, MGC133367, PLA2G10.
Shipping Condition Room temperature
Available
Shipping Temperature
Lyophilized powder at room temperature.
Usage statement
Usage Statement: Our products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Description
Secreted Phospholipase A2-X Human Recombinant is manufactured with N-terminal fusion HisTag. PLA2G10 His-Tagged Fusion Protein, is 15.5 kDa containing 123 amino acid residues of the human secreted phospholipase A2-X and 16 additional amino acid residues - HisTag (underlined).MRGSHHHHHHGMASHMGILELAGTVGCVGPRTPIAYMKYGCFCGLGGHGQPRDAIDWCCHGHDCCYTRAEEAGCSPKTERYSWQCVNQSVLCGPAENKCQELLCKCDQEIANCLAQTEYNLKYLFYPQFLCEPDSPKCD.
Physical Appearance and Stability: Store lyophilized protein at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4C for a limited period of time; it does not show any change after two weeks at 4C.
Formulation and Purity: Sterile filtered and lyophilized from 0.5 mg/ml in 0.01M Tris buffer pH 7.2. Greater than 95% as determined by SDS PAGE.
Solubility: Add 0.2 ml of distilled water and let the lyophilized pellet dissolve completely.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 2 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close