Comparison

Elf3 Antibody - N-terminal region

Item no. ARP36846_P050-25UL
Manufacturer AVIVA Systems Biology
Amount 25 ul
Category
Type Antibody Polyclonal
Format Liquid
Applications WB, IHC
Specific against Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host Rabbit
Sequence MAATCEISNVFSNYFNAMYSSEDPTLAPAPPTTFGTEDLVLTLNNQQMTL
Citations Namiki, T., Valencia, J. C., Hall, M. D. & Hearing, V. J. A novel approach to enhance antibody sensitivity and specificity by peptide cross-linking. Anal. Biochem. 383, 265-9 (2008). 18801330
Do,H.J., (2006) FEBS Lett. 580 (7), 1865-1871
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias ES,je,ESX,jen,ESE-,ESE-1
Shipping Condition Cool pack
Available
Manufacturer - Type
Polyclonal Antibody
Manufacturer - Category
Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Transcription Factor, Root Catalog/Research Areas/Chromatin & Nuclear Signaling, Root Catalog/Research Areas/Developmental Biology, Root Catalog/Research Areas/Signal Transduction, Root Catalog/Research Areas/Immunohistochemistry, Root Catalog/Research Areas/Cell Structure, Root Catalog/Research Areas/Transcription Factors, Root Catalog/Research Areas/Cell Differentiation, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature
Wet Ice
Molecular Weight
41kDa
Species Tested
Human, Mouse
Gene symbol
ELF3
Gene Fullname
E74-like factor 3
Protein size
371
Product format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Description of target
Elf3 is a transcriptional activator that binds and transactivates ETS sequences containing the consensus nucleotide core sequence GGA[AT]. It acts synergistically with POU2F3 to transactivate the SPRR2A promoter and with RUNX1 to transactivate the ANGPT1 promoter (By similarity). It also transactivates collagenase, CCL20, CLND7, FLG, KRT8, NOS2, PTGS2, SPRR2B, TGFBR2 and TGM3 promoters. IT represses KRT4 promoter activity (By similarity). It may play an important role in epithelial cell differentiation and tumorigenesis and may be a critical downstream effector of the ERBB2 signaling pathway (By similarity). It may be associated with mammary gland development and involution. It plays an important role in the regulation of transcription with TATA-less promoters in preimplantation embryos, which is essential in preimplantation development.
Nucleotide accession_num
NM_007921
Protein accession_num
NP_031947
Protein name
ETS-related transcription factor Elf-3
Clonality
Polyclonal
Purification
Affinity Purified
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of mouse Elf3
Homology
Mouse: 100%; Rat: 93%
Concentration
0.5 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 25 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close