Comparison

Foxa2 Antibody - C-terminal region

Item no. ARP37059_P050-25UL
Manufacturer AVIVA Systems Biology
Amount 25 ul
Category
Type Antibody Polyclonal
Format Liquid
Applications WB
Specific against Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host Rabbit
Sequence VDVEGTDYLNGDLGWSSSVSDSDERGSMQSLGSDEGYSSATVKRAKLQDG
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias Hnf3,Hnf-3,Hnf3b,Tcf3b,HNF3be,Hnf-3b,Tcf-3b,HNF3-be,HNF3beta,HNF3-beta
Shipping Condition Cool pack
Available
Manufacturer - Type
Polyclonal Antibody
Manufacturer - Category
Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Transcription Factor, Root Catalog/Products/Polyclonal Antibodies/RNA Binding Proteins, Root Catalog/Research Areas/Chromatin & Nuclear Signaling, Root Catalog/Research Areas/Developmental Biology, Root Catalog/Research Areas/Cell Structure, Root Catalog/Research Areas/Transcription Factors, Root Catalog/Research Areas/Cell Differentiation, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature
Wet Ice
Molecular Weight
48kDa
Species Tested
Mouse
Gene symbol
FOXA2
Gene Fullname
Forkhead box A2
Protein size
459
Product format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins
Ucp2; Gck; Pklr; Hnf4a; Igfbp1; Acadm; Acadvl;
Description of target
Foxa2 is a transcription factor that is involved in embryonic development, establishment of tissue-specific gene expression and regulation of gene expression in differentiated tissues. Foxa2 is thought to act as a 'pioneer' factor opening the compacted chromatin for other proteins through interactions with nucleosomal core histones and thereby replacing linker histones at target enhancer and/or promoter sites. In embryonic development Foxa2 is required for notochord formation. Foxa2 is involved in the development of multiple endoderm-derived organ systems such as the liver, pancreas and lungs; Foxa1 and Foxa2 seem to have at least in part redundant roles. Foxa2 modulates the transcriptional activity of nuclear hormone receptors; inhibits AR-mediated transcription from the LCN5 promoter. Foxa2 binds to fibrinogen beta promoter and is involved in IL6-induced fibrinogen beta transcriptional activation. Foxa2 interacts with the cis-acting regulatory regions of these genes. Foxa2 is involved in glucose homeostasis; regulates the expression of genes important for glucose sensing in pancreatic beta-cells and glucose homeostasis. Foxa2 is involved in regulation of fat metabolism; activates transcriptional programs of lipid metabolism and ketogenesis at low insulin state.
Nucleotide accession_num
NM_010446
Protein accession_num
NP_034576
Protein name
Hepatocyte nuclear factor 3-beta
Clonality
Polyclonal
Purification
Affinity Purified
Immunogen
The immunogen is a synthetic peptide corresponding to a region of Mouse
Homology
Mouse: 100%; Rat: 86%
Concentration
0.5 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 25 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close