« Back
Home /
RNF40 Antibody

RNF40 Antibody

Item no.	OAAL00477
Manufacturer	AVIVA Systems Biology
Amount	100 ug
Category	Oncology Antibodies By Cell Type Blastoma Carcinoma Glioma Hematology Leukemia Lymphoma Myeloma Melanoma Sarcoma Cell Biology Cell Status Western Blot ELISA Immunofluorescence Senescence Primary Antibodies Astrocytoma By Organ Bladder Cancer Immunostaining Bone Cancer
Type	Antibody Monoclonal
Format	Liquid
Applications	WB, IF, ELISA
Clone	1C1
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host	Mouse
Isotype	IgG2a Kappa
Sequence	DETVEALLRCHESQGELSSAPEAPGTQEGPTCDGTPLPEPGTSELRDPLLMQLRPPLSEPALAFVVALGASSSEEVELELQGRMEFSKAAVSRVVEASD
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	95 kDa retinoblastoma protein binding protein;95 kDa retinoblastoma-associated protein;BRE1 E3 ubiquitin ligase homolog B;BRE1B;BRE1-B;E3 ubiquitin-protein ligase BRE1B;Rb-associated protein;RBP95;ring finger protein 40,E3 ubiquitin protein ligase;RING-type E3 ubiquitin transferase BRE1B;STARING.
Shipping Condition	Cool pack
Available
Manufacturer - Type	Monoclonal Antibody
Manufacturer - Category	Root Catalog/Products/Monoclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature	Wet Ice
Gene symbol	RNF40
Gene Fullname	ring finger protein 40
Product format	Liquid
Reconstitution and storage	Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Description of target	The protein encoded by this gene contains a RING finger, a motif known to be involved in protein-protein and protein-DNA interactions. This protein was reported to interact with the tumor suppressor protein RB1. Studies of the rat counterpart suggested that this protein may function as an E3 ubiquitin-protein ligase, and facilitate the ubiquitination and degradation of syntaxin 1, which is an essential component of the neurotransmitter release machinery. [provided by RefSeq
Nucleotide accession_num	NM_014771
Protein accession_num	https://www.ncbi.nlm.nih.gov/protein/NP_055586
Protein name	E3 ubiquitin-protein ligase BRE1B isoform 1 [Homo sapiens]\|Homo sapiens ring finger protein 40 (RNF40), transcript variant 1, mRNA
Clonality	Monoclonal
Immunogen	RNF40 (NP_055586, 102 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Formulation	In 1x PBS, pH 7.4

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

OAAL00477-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 12/25/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer