Comparison

Mouse anti-Glypican-3 (511~560aa) (8C4-C1-F4)

Manufacturer Raybiotech
Category
Type Antibody
Specific against Human
Clone 8C4-C1-F4
Applications ELISA
Amount 200 ug
Host Hamster - Armenian
Item no. 131-0087-200
Targets GPC1;;GPC3
eClass 6.1 32160702
eClass 9.0 32160702
Available
Application Information
ELISA (recommended work dilution = 1:80, 000)
Protein Name & Synonyms
Glypican-3 (511~560aa)
Reconstitution
Product is supplied as a powder obtained from lyophilization of purified antibody in 1X PBS, aliquot using ddH2O. Reconstitute the antibody with sterile water to a final concentration of 1 mg/ml.
Expiration
12 months from the date of shipment when stored properly.
Clonality
Monoclonal
Preparation
Immunogen was polypeptide Glypican-3 (511~560aa)-KLH:DGMIKVKNQLRFLAELAYDLDVDDAPGNSQQATPKDNEISTFHNLGNVHS. This antibody was produced from a hybridoma resulting from the fusion of a mouse myeloma with B cells obtained from a mouse immunized with the immunogen. The IgG fraction of tissue culture supernatant was purified by Protein G/A affinity chromatography.
Western Blot
10% SDS-PAGE, Goat anti-mouse HRP: 1:5000.Lane:M: protein marker1: HepG2 cell lysate (10 µl)2: Hela cell lysate (10 µl)3: Mouse Liver lysate (10 µl)StorageThe antibody is stable for at least 1 year from the date of receipt when stored at -20°C to -70°C. Reconstituted antibody can also be aliquotted and stored at 4°C for 1 month or at -20°C to -70°C in a manual defrost freezer for many months without detectable loss activity. Please avoid freeze-thaw cycles.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 200 ug
Available: In stock
available

Delivery expected until 5/30/2024 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close