Comparison

ORP150/GRP170/HSP12A Rabbit mAb European Partner

Item no. A1042-50ul
Manufacturer Abclonal
Amount 50 ul
Quantity options 1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category
Type Antibody Primary
Applications WB, ELISA, IHC-P
Specific against Human (Homo sapiens)
Host Rabbit
Isotype IgG
Conjugate/Tag Unconjugated
Purity Affinity purification
Sequence MADKVRRQRPRRRVCWALVAVLLADLLALSDTLAVMSVDLGSESMKVAIVKPGVPMEIVLNKESRRKTPVIVTLKENERFFGDSAASMAIKNPKATLRYFQHLLGKQADNPHVALYQARFPEHELTFDPQRQTVHFQISSQLQFSPEEVL
NCBI HYOU1
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias IMD59,Grp170,HSP12A,ORP150,GRP-170,ORP-150,ORP150/GRP170/HSP12A
Shipping Condition Cool pack
Available
Manufacturer - Category
Monoclonal Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Protein Weight
111kDa
Background
The protein encoded by this gene belongs to the heat shock protein 70 family. This gene uses alternative transcription start sites. A cis-acting segment found in the 5' UTR is involved in stress-dependent induction, resulting in the accumulation of this protein in the endoplasmic reticulum (ER) under hypoxic conditions. The protein encoded by this gene is thought to play an important role in protein folding and secretion in the ER. Since suppression of the protein is associated with accelerated apoptosis, it is also suggested to have an important cytoprotective role in hypoxia-induced cellular perturbation. This protein has been shown to be up-regulated in tumors, especially in breast tumors, and thus it is associated with tumor invasiveness. This gene also has an alternative translation initiation site, resulting in a protein that lacks the N-terminal signal peptide. This signal peptide-lacking protein, which is only 3 amino acids shorter than the mature protein in the ER, is thought to have a housekeeping function in the cytosol. In rat, this protein localizes to both the ER by a carboxy-terminal peptide sequence and to mitochondria by an amino-terminal targeting signal. Alternative splicing results in multiple transcript variants.
Manufacturer - Cross Reactivity
Human, Mouse, Rat
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human ORP150/GRP170/HSP12A (Q9Y4L1).
Recommended Dilution
WB, 1:500 - 1:1000|IHC-P, 1:50 - 1:200
Protein Size
111kDa
Route
Recombinant protein
Manufacturer - Research Area
Epigenetics Nuclear Signaling, Cancer, Invasion and Metastasis, Signal Transduction, Endocrine Metabolism, Neuroscience, Neurodegenerative Diseases, Cardiovascular, Hypoxia.
Antigen Seq
MADKVRRQRPRRRVCWALVAVLLADLLALSDTLAVMSVDLGSESMKVAIVKPGVPMEIVLNKESRRKTPVIVTLKENERFFGDSAASMAIKNPKATLRYFQHLLGKQADNPHVALYQARFPEHELTFDPQRQTVHFQISSQLQFSPEEVL
Manufacturer - Gene ID (Human)
10525
Expected Protein Size
111kDa
Gene Symbol
HYOU1

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 50 ul
Available: In stock
available

Delivery expected until 12/18/2025 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close